Property Summary

NCBI Gene PubMed Count 8
PubMed Score 19.30
PubTator Score 6.02

Knowledge Summary


No data available



Gene RIF (3)

23173898 A description of two novel OTOA mutations that were discovered in three consanguineous Pakistani families segregating autosomal recessive non-syndromic hearing impairment.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19888295 Large deletions in OTOA gene is associated with hearing loss.

AA Sequence

TRTSSSRSPAGALQSWGLWLGCPLLVLMAKLLW                                        1121 - 1153

Text Mined References (10)

PMID Year Title
23173898 2013 Novel OTOA mutations cause autosomal recessive non-syndromic hearing impairment in Pakistani families.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19888295 2010 Five novel loci for inherited hearing loss mapped by SNP-based homozygosity profiles in Palestinian families.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19088187 2008 Genome-wide analysis of cancer/testis gene expression.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11972037 2002 Otoancorin, an inner ear protein restricted to the interface between the apical surface of sensory epithelia and their overlying acellular gels, is defective in autosomal recessive deafness DFNB22.