Property Summary

NCBI Gene PubMed Count 101
PubMed Score 151.69
PubTator Score 938.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
ovarian cancer 8297 8.4e-09
colon cancer 1428 8.0e-07
medulloblastoma, large-cell 6086 1.9e-05
adult high grade glioma 3701 3.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Kidney cancer 2548 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.200 3.6e-03
colon cancer -2.300 8.0e-07
medulloblastoma, large-cell 1.200 1.9e-05
ovarian cancer 1.200 8.4e-09

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (34)

AA Sequence

MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK      1 - 70
GEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLA     71 - 140
RVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAK    141 - 210
FGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQA    211 - 280
FQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQ    281 - 350
KPKF                                                                      351 - 354
//

Text Mined References (107)

PMID Year Title