Property Summary

NCBI Gene PubMed Count 25
PubMed Score 40.56
PubTator Score 80.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -2.000 7.1e-08
astrocytic glioma -1.700 2.6e-02
oligodendroglioma -1.900 1.8e-02
esophageal adenocarcinoma -1.400 2.4e-02
psoriasis 1.300 3.1e-04
medulloblastoma -1.900 1.7e-04
atypical teratoid / rhabdoid tumor -2.300 1.0e-07
glioblastoma -1.500 2.3e-05
medulloblastoma, large-cell -3.000 1.0e-07
primitive neuroectodermal tumor -1.600 5.0e-04
lung cancer -1.500 3.2e-04
diabetes mellitus -1.100 2.0e-02
adult high grade glioma -1.300 8.2e-03
ovarian cancer 1.800 2.3e-05

Gene RIF (7)

PMID Text
21501342 Data show that SH3P2 was phosphorylated on Ser(202) by ribosomal S6 kinase (RSK) in an ERK pathway-dependent manner, and such phosphorylation inhibited the ability of SH3P2 to suppress cell motility.
20424473 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19137598 The peptide-binding groove of OSTF-SH3 domain adopts a conformation different from other SH3 domains and probably needs a conformational switch for binding to its proline-rich ligand; this status is possibly regulated by the C-terminal ankyrin repeats.
16946461 The SH3 domain structure of osteoclast stimulating factor at atomic resolution provides an accurate framework for structure-based design of its inhibitors.
16508112 Crystals of human osteoclast-stimulating factor were obtained by the hanging-drop vapour-diffusion method using X ray crystallography.
15135048 SH3P2, a novel component of adhesion sites, is involved in Cbl and Src-mediated pathways

AA Sequence

MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQA      1 - 70
ESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKDIVEMLFTQPNIELNQQNKLG     71 - 140
DTALHAAAWKGYADIVQLLLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDAVRTLSNAEDYLDD    141 - 210
EDSD                                                                      211 - 214
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21501342 2011 SH3P2 is a negative regulator of cell motility whose function is inhibited by ribosomal S6 kinase-mediated phosphorylation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19137598 2009 Crystal structure of human osteoclast stimulating factor.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18088087 2008 Phosphoproteome of resting human platelets.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16946461 2006 Structure of the SH3 domain of human osteoclast-stimulating factor at atomic resolution.
16508112 2005 Crystallization and preliminary X-ray crystallographic analysis of osteoclast-stimulating factor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15135048 2004 SH3P2 in complex with Cbl and Src.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11551898 2001 Osteoclast-stimulating factor interacts with the spinal muscular atrophy gene product to stimulate osteoclast formation.
10773673 2000 Assignment of OSTF1 to human chromosome bands 12q24.1-->q24.2 by in situ hybridization.
10092216 1998 Isolation and characterization of a cDNA clone encoding a novel peptide (OSF) that enhances osteoclast formation and bone resorption.
9630982 1996 Cloning of ligand targets: systematic isolation of SH3 domain-containing proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.