Property Summary

NCBI Gene PubMed Count 47
PubMed Score 170.47
PubTator Score 45.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Amyloidosis 68 5.311 2.7

Expression

  Differential Expression (33)

Disease log2 FC p
psoriasis 1.500 1.1e-03
glioblastoma multiforme 1.900 8.9e-16
osteosarcoma 3.152 1.2e-04
posterior fossa group A ependymoma 1.800 5.3e-06
non diabetic and post-ischemic heart fai... -1.500 5.1e-03
atypical teratoid/rhabdoid tumor 1.800 2.4e-03
group 4 medulloblastoma -1.500 1.7e-03
medulloblastoma, large-cell -2.100 3.5e-04
juvenile dermatomyositis 1.334 1.5e-11
limb girdle muscular dystrophy 2B 1.033 4.0e-04
acute quadriplegic myopathy 1.028 4.4e-05
primary pancreatic ductal adenocarcinoma 2.393 2.7e-04
non-small cell lung cancer 1.828 7.3e-15
intraductal papillary-mucinous adenoma (... -1.500 1.6e-02
lung cancer -2.900 2.3e-06
sarcoidosis -1.200 2.7e-02
diabetes mellitus -1.600 2.1e-02
interstitial cystitis 2.000 1.9e-05
pediatric high grade glioma 1.700 1.5e-03
pilocytic astrocytoma 2.800 6.9e-10
aldosterone-producing adenoma -1.314 4.0e-02
subependymal giant cell astrocytoma 1.730 2.5e-02
lung adenocarcinoma 1.400 6.5e-06
lung carcinoma -3.400 6.5e-32
spina bifida -1.115 2.7e-02
gastric carcinoma 2.000 8.1e-03
mucosa-associated lymphoid tissue lympho... 1.408 2.8e-02
ulcerative colitis 3.500 2.0e-08
ovarian cancer 3.400 5.8e-08
Gaucher disease type 1 -1.200 3.7e-02
pituitary cancer -2.700 4.5e-08
pancreatic cancer 2.400 8.5e-04
head and neck cancer 1.700 1.4e-04

Protein-protein Interaction (2)

Gene RIF (33)

PMID Text
26356818 the RET p.S891A mutation combined with OSMR p.G513D may underlie a novel phenotype manifesting as familial medullary thyroid carcinoma and cutaneous amyloidosis
26311783 OSMRBeta in neurons is critical for neuronal survival during cerebral ischemic/reperfusion.
26198770 Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology.
25792357 this study offers new findings on the molecular genetics and disease relevance of mutations in OSMR in Familial primary localized cutaneous amyloidosis.
25283844 The interleukin IL-31/IL-31receptor axis contributes to tumor growth in human follicular lymphoma.
25054142 primary localized cutaneous amyloidosis has a missense mutation in oncostatin M receptor beta
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of oncostatin M receptor (OSMR) in primary human brain microvascular endothelial cells
24418171 oncostatin M is a cytokine possessing vigorous antiviral and immunostimulatory properties which is released by APC upon interaction with CD40L present on activated CD4+ T cells.
24219225 The disease severity of rheumatoid arthritis and systemic lupus erythematosus can be partially affected by the OSMR promoter polymorphisms.
23765377 We conclude that an OSMR/TGM2/integrin-alpha5beta1/fibronectin pathway is of biological significance in cervical squamous cell carcinoma
22829597 A unique loop structure in oncostatin M determines binding affinity toward oncostatin M receptor and leukemia inhibitory factor receptor.
22137028 enhanced production by beta-defensin-2 in T cells
22062952 This study identified a new heterozygous OSMR missense mutation in primary localized cutaneous amyloidosis.
21952923 We conclude that OSMR overexpression in cervical SCC cells provides increased sensitivity to OSM, which induces pro-malignant changes.
21508378 Aberrant methylation of the OSMR gene is associated with non-invasive colorectal cancer.
21394648 An alternatively spliced variant of OSMR transcribing a soluble form of this receptor has been characterized in esophageal squamous cell carcinoma.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20507362 Two new pathogenic heterozygous missense mutations in the OSMR gene (p.Val631Leu and p.Asp647Tyr) were identified in two Dutch familial primary localized cutaneous amyloidosis families.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20205591 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19690585 The identification of OSMR and IL31RA gene pathology provides an explanation of the high prevalence of primary cutaneous amyloidosis in Taiwan as well as new insight into disease pathophysiology.
19662090 provides a biologic rationale for silencing of OSMR in colon cancer progression and highlight a new therapeutic target. Moreover, detection and quantification of OSMR promoter methylation in fecal DNA is a highly specific diagnostic biomarker for CRC
19466957 study provides evidence for the existence of a novel pathogenic mutation in the OSMR gene in a caucasian family with familial primary cutaneous amyloidosis
19375894 study reporta a Japanese family with familial primary localized cutaneous amyloidosis in whom a novel OSMR mutation was observed
19223499 Epigenetic silencing and DNA methylation of OSMR is associated with colorectal cancers.
19158344 The renal parenchyma is capable of generating a strong acute phase response, likely mediated via OSM/OSMR.
18641356 IL-6 and Oncostatin M individually affect the profile of leukocyte trafficking
18430728 murine OSMR initiates STAT5 activation directly via the receptor bound Janus kinases. Intriguingly, the murine receptor preferentially recruits JAK2, whereas the human receptor seems to have a higher affinity for JAK1.
18179886 FPLCA has been mapped to 5p13.1-q11.2, and by candidate gene analysis, study identified missense mutations in the OSMR gene, encoding oncostatin M-specific receptor beta (OSMRbeta), in three families.
17028186 sOSMR is able to bind OSM and interleukin-31 when associated to soluble gp130 or soluble interleukin-31R, respectively, and to neutralize both cytokine properties
15831292 The expression of OSM and its receptor in ovarian tissue from fetuses and women suggests a possible role of OSM in growth initiation of human primordial follicles.
12061840 expression and evidence for STAT3 activation in human ovarian carcinomas

AA Sequence

MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ      1 - 70
ISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSV     71 - 140
QDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKG    141 - 210
TNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFES    211 - 280
FSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAI    281 - 350
MTWKVHSIRNNFTYLCQIELHGEGKMMQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWSG    351 - 420
QNFTTLEAAPSEAPDVWRIVSLEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPSSSELHSIPAPA    421 - 490
NSTKLILDRCSYQICVIANNSVGASPASVIVISADPENKEVEEERIAGTEGGFSLSWKPQPGDVIGYVVD    491 - 560
WCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDFRIYGLSTKRIACLLEKKTGYSQELAPSDNPH    561 - 630
VLVDTLTSHSFTLSWKDYSTESQPGFIQGYHVYLKSKARQCHPRFEKAVLSDGSECCKYKIDNPEEKALI    631 - 700
VDNLKPESFYEFFITPFTSAGEGPSATFTKVTTPDEHSSMLIHILLPMVFCVLLIMVMCYLKSQWIKETC    701 - 770
YPDIPDPYKSSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYL    771 - 840
LPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPENVLKALEKNYMNSLGEIPA    841 - 910
GETSLNYVSQLASPMFGDKDSLPTNPVEAPHCSEYKMQMAVSLRLALPPPTENSSLSSITLLDPGEHYC     911 - 979
//

Text Mined References (50)

PMID Year Title
26356818 2015 RET mutation p.S891A in a Chinese family with familial medullary thyroid carcinoma and associated cutaneous amyloidosis binding OSMR variant p.G513D.
26311783 2015 Oncostatin M Confers Neuroprotection against Ischemic Stroke.
26198770 2015 Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology.
25792357 2015 Familial primary localized cutaneous amyloidosis results from either dominant or recessive mutations in OSMR.
25283844 2015 The interleukin (IL)-31/IL-31R axis contributes to tumor growth in human follicular lymphoma.
25054142 2014 A novel missense mutation in oncostatin M receptor beta causing primary localized cutaneous amyloidosis.
24418171 2014 Characterization of the CD40L/Oncostatin M/Oncostatin M receptor axis as an antiviral and immunostimulatory system disrupted in chronic HCV infection.
24219225 2014 Association of OSMR gene polymorphisms with rheumatoid arthritis and systemic lupus erythematosus patients.
23765377 2013 Tissue transglutaminase mediates the pro-malignant effects of oncostatin M receptor over-expression in cervical squamous cell carcinoma.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22829597 2012 A unique loop structure in oncostatin M determines binding affinity toward oncostatin M receptor and leukemia inhibitory factor receptor.
22137028 2012 Increased serum human ?-defensin-2 levels in atopic dermatitis: relationship to IL-22 and oncostatin M.
22062952 A new c.1845A?T of oncostatin M receptor-? mutation and slightly enhanced oncostatin M receptor-? expression in a Chinese family with primary localized cutaneous amyloidosis.
21952923 2011 Overexpression of the oncostatin M receptor in cervical squamous cell carcinoma cells is associated with a pro-angiogenic phenotype and increased cell motility and invasiveness.
21912637 2011 CNTF mediates neurotrophic factor secretion and fluid absorption in human retinal pigment epithelium.
21508378 2011 Methylation of OSMR gene is frequently observed in non-invasive colorectal cancer.
21394648 2011 Overexpression of a splice variant of oncostatin M receptor beta in human esophageal squamous carcinoma.
21261663 2011 Functional effects of interleukin 31 in human primary keratinocytes.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20507362 2010 The molecular skin pathology of familial primary localized cutaneous amyloidosis.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20205591 2010 Host determinants of HIV-1 control in African Americans.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19690585 2010 Novel IL31RA gene mutation and ancestral OSMR mutant allele in familial primary cutaneous amyloidosis.
19662090 2009 Promoter DNA methylation of oncostatin m receptor-beta as a novel diagnostic and therapeutic marker in colon cancer.
19466957 2009 Identification of an oncostatin M receptor mutation associated with familial primary cutaneous amyloidosis.
19375894 2009 A novel OSMR mutation in familial primary localized cutaneous amyloidosis in a Japanese family.
19223499 2009 Unique methylation pattern of oncostatin m receptor gene in cancers of colorectum and other digestive organs.
19158344 2009 Oncostatin M pathway plays a major role in the renal acute phase response.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18641356 2008 Oncostatin M receptor-beta signaling limits monocytic cell recruitment in acute inflammation.
18430728 2008 Box 2 region of the oncostatin M receptor determines specificity for recruitment of Janus kinases and STAT5 activation.
18179886 2008 Oncostatin M receptor-beta mutations underlie familial primary localized cutaneous amyloidosis.
17028186 2006 Molecular and functional characterization of a soluble form of oncostatin M/interleukin-31 shared receptor.
15831292 2005 Immunocytochemical detection and reverse transcription polymerase chain reaction expression of oncostatin M (OSM) and its receptor (OSM-Rbeta) in human fetal and adult ovaries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15184896 2004 Interleukin 31, a cytokine produced by activated T cells, induces dermatitis in mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12061840 2002 Coexpression of oncostatin M and its receptors and evidence for STAT3 activation in human ovarian carcinomas.
11786531 2002 Novel role of Janus kinase 1 in the regulation of oncostatin M receptor surface expression.
11706938 2001 Effects of oncostatin M on human cerebral endothelial cells and expression in inflammatory brain lesions.
11602599 2001 Oncostatin M regulates the synthesis and turnover of gp130, leukemia inhibitory factor receptor alpha, and oncostatin M receptor beta by distinct mechanisms.
10997905 2000 Crystal structure and functional dissection of the cytostatic cytokine oncostatin M.
10586060 1999 Contributions of leukemia inhibitory factor receptor and oncostatin M receptor to signal transduction in heterodimeric complexes with glycoprotein 130.
9662460 1998 Regulation of the type II oncostatin M receptor expression in lung-derived epithelial cells.
9617575 1998 Oncostatin M-specific receptor expression and function in regulating cell proliferation of normal and malignant mammary epithelial cells.
9188471 1997 Signaling of type II oncostatin M receptor.
8999038 1996 Dual oncostatin M (OSM) receptors. Cloning and characterization of an alternative signaling subunit conferring OSM-specific receptor activation.