Property Summary

NCBI Gene PubMed Count 125
PubMed Score 400.07
PubTator Score 379.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer -1.700 1.1e-03
hepatocellular carcinoma -1.700 4.5e-06
tuberculosis -2.200 7.4e-04
non-small cell lung cancer -1.059 1.7e-07
lung adenocarcinoma 1.100 4.0e-03
ulcerative colitis 1.500 1.3e-02
ovarian cancer 1.100 2.9e-02
psoriasis 3.900 1.9e-55

Protein-protein Interaction (6)

Gene RIF (99)

PMID Text
26399567 Nucleolin stabilizes oncostatin-M mRNA by binding to a GC-rich element in its 3'UTR.
26355153 administration of Fstl1 induced airway remodeling and increased OSM, whereas administration of an anti-OSM Ab blocked the effect of Fstl1 on inducing airway remodeling, eosinophilic airway inflammation
26311783 Oncostatin M regulates neuronal function and confers neuroprotectin in an animal model of ischemic stroke.
26304992 OSM expression in osteoblasts increases in response to Osteopontin-induced inflammation in vitro.
26198770 Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology.
25954856 we demonstrated that recombinant human OSM (rhOSM) promoted tumor angiogenesis in EC cell lines by activating STAT3 (signal transducer and activator of transcription 3) and enhanced both cell migration and cell inva
25849622 Oncostatin M can regulate airway smooth muscle responses alone or in synergy with IL-17A.
25845347 The Notch signaling pathway was found to be one of the signaling pathways that inhibit OSM-induced MC3T3-E1 cell proliferation and differentiation.
25840724 OSM promotes mucosal epithelial barrier dysfunction, and its expression is increased in patients with eosinophilic mucosal disease.
25804939 In patients with diabetes, bone marrow plasma OSM levels were higher and correlated with the bone marrow to peripheral blood stem cell ratio.
25735629 Data suggest that OSM promotes osteoblastic differentiation of vascular smooth muscle cells through JAK3/STAT3 pathway and may contribute to the development of atherosclerotic calcification.
25252914 Autocrine activation of STAT3 in MCF-7 cells ectopically expressing OSM-induced cellular scattering.
24710357 OSM promotes STAT3-dependent intestinal epithelial cell proliferation and wound healing in vitro.
24600984 data suggest that increased serum OSM levels are associated with the coronary stenosis score and that circulating levels of this chemokine may reflect the extent of coronary atherosclerosis
24418171 oncostatin M is a cytokine possessing vigorous antiviral and immunostimulatory properties which is released by APC upon interaction with CD40L present on activated CD4+ T cells.
24297795 white adipose tissue macrophages are a source of OSM and OSM levels are significantly induced in obesity/type 2 diabetes. OSM produced from immune cells in WAT may act in a paracrine manner on adipocytes to promote inflammation in adipose tissue.
23867565 Data indicate that pro-inflammatory cytokines such as IL6 or OSM could activate pathways associated with prostate cancer progression and synergize with cell-autonomous oncogenic events to promote aggressive malignancy.
23735324 TGFBI and periostin, extracellular matrix proteins implicated in tumorigenesis and metastasis, were identified as oncostatin M-induced secreted proteins in mesenchymal stem cells.
23621172 Oncostatin M is a FIP1L1/PDGFRA-dependent mediator of cytokine production in chronic eosinophilic leukemia.
23584474 OSM may promote a clinically relevant EMT/CSC-like phenotype in human breast cancer via a PI3K-dependent mechanism
23313749 These data show that OSM and IL-1beta are not only a biological characteristic signature of hypertensive leg ulcer, but these cytokines reflect a specific inflammatory state, directly involved in the pathogenesis.
22982441 OSM induced proliferation of Ewing sarcoma cell lines.
22931588 Data suggest that OSM enhances invasion activities of extravillous trophoblasts during placentation through increased enzyme activity of MMP-2 (primarily) and MMP-9 (to some extent).
22829597 A unique loop structure in oncostatin M determines binding affinity toward oncostatin M receptor and leukemia inhibitory factor receptor.
22267707 Oncostatin M signaling may cause suppression of estrogen receptor-alpha and disease progression i breast cancer.
22267310 Oncostatin M (OSM), a cytokine of the IL-6 family, was identified as a major coupling factor produced by activated circulating CD14+ or bone marrow CD11b+ monocytes/macrophages.
22082156 Knockdown of oncostatin M (OSM) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
22056139 Oncostatin M (OSM) is a major mediator of cardiomyocyte dedifferentiation and remodeling during acute myocardial infarction (MI) and in chronic dilated cardiomyopathy (DCM).
22051730 JAK2 V617F-mediated up-regulation of OSM may contribute to fibrosis, neoangiogenesis, and the cytokine storm observed in myeloproliferative neoplasms.
21975934 c-MYC is an important molecular switch that alters the cellular response to OSM-mediated signaling from tumor suppressive to tumor promoting.
21965736 A possible interaction between IL-6, OSM, u-PA and VEGF in prostate cancer was investigated.
21775705 This report uses an in vitro model with human umbilical vein endothelial cells and isolated human neutrophils to examine the effects of two locally derived cytokines, granulocyte-macrophage colony-stimulating factor and G-CSF, on oncostatin M expression.
21481226 promotes STAT3 activation, VEGF production, and invasion in osteosarcoma cell lines
21457934 Taken together, our data show that KIT D816V promotes expression of OSM through activation of STAT5.
21399864 The purpose of this study was to investigate the possible suppressive or stimulatory role of OSM in the ovarian cancer model of SKOV3 cells, as well as the involvement of the ERK1/2, p38 and STAT3 signaling pathways.
21376322 OSM is expressed in atherosclerotic lesions and may contribute to the progression of atherosclerosis by promoting SMC proliferation, migration and extracellular matrix protein synthesis through the STAT pathway
21196532 a cytokine-triggered regulatory network for PCSK9 expression that is linked to JAKs and the ERK signaling pathway
20661773 The expression and secretion of oncostatin M and of its receptor were strongly up-regulated by Helicobacter pylori or by Helicobacter pylori culture supernatant. Oncostatin M secretion was independent of the CagA, VacA or Type IV secretion system.
20650266 OSM, and to a lesser degree IL-6, induces the expression of Grp78/BiP, an ER chaperone associated with tumor development and poor prognosis in cancer.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20626292 elevated expression in kidneys from patients with urinary obstruction
20408777 oncostatin M is a gp 130 cytokine inflammatory biomarker that has a role in periodontal disease
20237496 Observational study of gene-disease association. (HuGE Navigator)
20189410 The greater the amount of periodontal tissue destruction there is substantial increase in gingival crevicular fluid OSM concentrations.
20149034 OSM may play a biological marker for severe preeclampsia, and its action may be predominantly on the trophoblasts and endothelium of placenta villi in preeclampsia.
20101226 Inflammatory cytokines oncostatin-M and interleukin-6 can regulate S100A7 expression and that S100A7 may mediate some of their effects in breast cancer.
20088942 Findings provide evidence that the inflammatory cytokine oncostatin M is involved in modulation of the Ang-Tie system by increasing Ang2 expression in human endothelial cells in vitro, and in murine hearts and human hearts in vivo.
19916861 Sputum oncostatin M is increased in asthma with irreversible airflow obstruction and is present in airway neutrophils and macrophages
19913121 Observational study of gene-disease association. (HuGE Navigator)
19652200 The coagulation enzyme thrombin up-regulates oncostatin M via AP-1 activation in macrophages.
19565514 Oncostatin M can strongly up-regulate the expression of CCL13, a chemokine recently identified in the synovial fluid of patients with rheumatoid arthritis.
19342253 Results indicate that leukemia inhibitory factor (LIF) and Oncostatin M increase the expression of MMP-1, MMP-3, and TIMP-1 several fold, and that their expression is reduced to basal levels in the presence of the LIF antagonist MH35-BD.
19158344 The renal parenchyma is capable of generating a strong acute phase response, likely mediated via OSM/OSMR.
19158240 Oncostatin M enhances the antiviral effects of type I interferon and cooperates with it in the induction of adaptive immune responses to pathogens.
19148539 by conducting site-directed mutagenesis, bioassays and molecular modeling we have defined 4 OM residues that are differently involved in the activation of ERK or STAT signaling pathway in HepG2 cells.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19019853 These data suggest that oncostatin M might play a key role in repair and tissue regeneration via the induction of stromal cell derived factor 1.
18981157 human OSM is able to induce CCL1, CCL7, and CCL8 expression to levels comparable to those found for IL-1beta and TNF-alpha
18772145 hXOR is a tumor suppressor-targeted gene and the phosphorylation of SAFB1 is regulated by OSM, which provides a molecular basis for understanding the role of SAFB1-regulated hXOR transcription in cytokine stimulation and tumorigenesis
18637848 expressed in epithelialized apical periodontitis lesions
18564531 Oncostatin M is expressed in both chronic obstructive sialadenitis and normal submandibular gland, and is up-regulated in chronic obstructive sialadenitis.
18499891 loss of repopulating activity during KIT-ligand stimulation is counteracted by Oncostatin M through the downregulation of ERK pathway signaling
18398932 Mtb infection of monocytes results in prostaglandin-dependent OSM secretion, which synergizes with TNF-alpha to drive functionally unopposed fibroblast MMP-1/-3 secretion.
18317962 secretion of OSM and LIF by both epithelial and stromal (paracrine manner) cells seems to promote tumor growth in human breast carcinoma
18187666 Our data establish a link between the complement system and the gp130 receptor cytokine family with possible implications for the pathology of inflammatory diseases.
18028996 Production of OSM by human mast cells might represent one link between T cell-induced mast cell activation and development of spectrum of structural changes in T cell-mediated inflammatory processes in which mast cells have been found to be involved.
17979974 Increased expression of some IL-6 cytokine family members (oncostatin M, gp130, CT-1, LIF) in cutaneous inflammation might contribute to the promotion of hair loss.
17881458 In human proximal tubular cells ERK1/2 signaling represents an important component of oncostatin M inhibitory effect on N-cadherin expression.
17761945 Oncostatin M directly lowers the plasma triglycerides in hyperlipidemia by stimulating the transcription of ACSL3/5 in the liver.
17604327 If the effect of oncostatin M on PAI-1 in smooth muscle cells is operative in vivo, it could, via fibrinolysis and proteolysis, be involved in plaque progression, destabilization, thrombus formation, restenosis, and neointima formation.
17471233 in addition to growth arrest and induced differentiation, OSM also sensitizes normal and transformed osteoblasts to apoptosis by a mechanism implicating (i) activation and nuclear translocation of STAT5 and p53 and (ii) an increased Bax/Bcl-2 ratio.
17372020 OSM and its receptor play an important role in cutaneous inflammatory responses in general and the specific effects of OSM are associated with distinct inflammatory diseases depending on the cytokine environment.
17081797 These results suggest that OSM inhibits adiponectin expression by inducing dedifferentiation of adipocytes through signaling pathways involving JAK3 and MEK, but not JAK2.
17028186 sOSMR is able to bind OSM and interleukin-31 when associated to soluble gp130 or soluble interleukin-31R, respectively, and to neutralize both cytokine properties
17009243 data suggest that OSM promotes angiogenesis and endothelial cell migration and potentiates the effects of IL-1beta in promoting extracellular matrix turnover and human cartilage degradation
16802343 Pre-B cell colony-enhancing factor (PBEF) is regulated via IL-6 trans-signaling and the IL-6-related cytokine OSM. PBEF is also actively expressed during arthritis.
16713283 OSM induces a motile/invasive phenotype in T-47D human breast cancer cells in vitro; OSM may enhance metastasis in vivo.
16369169 Oncostatin M is expressed in the human nasal mucosa and is upregulated in the setting of allergic nasal inflammation.
15863389 OSM may play a role in modulating the inflammatory cascade of chronic periodontitis.
15837947 IL-6 and OSM upregulate PAI-1 protein and mRNA in adipose tissue
15831292 The expression of OSM and its receptor in ovarian tissue from fetuses and women suggests a possible role of OSM in growth initiation of human primordial follicles.
15809742 Effects of OSM in 5 glioma cell lines and 7 short-term cultures of human gliomas and in normal cultured human astrocytes.
15712220 IL-6 stimulates proliferation of prostate cancer 22Rv1 cells, in part through activation of the phosphatidylinositol 3-kinase (PI 3-K) signaling pathway.
15146412 this important cytokine is released from neutrophils as they infiltrate rheumatoid joints and, thus, contribute to the complex cytokine network that characterizes rheumatoid arthritis
12707269 Leukemia inhibitory factor (LIF), cardiotrophin-1, and oncostatin M share structural binding determinants in the immunoglobulin-like domain of LIF receptor
12692260 oncostatin M, which transmits its signal via the gp130 cell surface receptor, and results in the selective down-modulation of the melanocyte lineage antigens
12640208 Increased production of this protein is found in lymphomononuclear cells from HIV-1-infected patients with neuroAIDS.
12531804 Kaposi sarcoma-associated viral cyclin K overrides cell growth inhibition mediated by this protein through STAT3 inhibition.
12391243 Raised intraperitoneal levels of OSM during bacterial infections originate from infiltrating neutrophils and regulate mesothelial expression of inflammatory cytokines.
12218157 Oncostatin M stimulates (45)Ca release and enhances mRNA expression of receptor activator of NF-kappa B ligand (RANKL) and osteoprotegerin in neonatal mouse calvarial bone cultures, but has no effect on the expression of RANK.
12138373 Oncostatin M induces procoagulant activity in human vascular smooth muscle cells by modulating the balance between tissue factor and tissue factor pathway inhibitor. OSM might be involved in the thrombotic complications associated with plaque rupture.
12090757 Oncostatin M induces tissue-type plasminogen activator and plasminogen activator inhibitor-1 in lung tumor cells
12061841 produced in human dendritic cells in response to bacterial products
12061840 expression and evidence for STAT3 activation in human ovarian carcinomas
11936950 role in inducing alpha1-antitrypsin gene expression
11839742 role in identifying sterol-indendent regulatory elements in human ATP-binding cassette transporter A1 promoter
11818668 Il-6 and oncostatin M act synergistically to promote growth in a new human myeloma cell line.
11811789 Oncostatin M and leukemia inhibitory factor regulate the growth of normal human breast epithelial cells
11777927 We conclude that STAT1 activation is necessary but not sufficient for induction of transcription of IFN gamma-responsive genes; signals provided by IFN gamma other than STAT1 activation cannot be provided in trans to complement the response to OnM.

AA Sequence

MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKL      1 - 70
REHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMAR     71 - 140
PNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFS    141 - 210
KWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR                                211 - 252
//

Text Mined References (126)

PMID Year Title
26399567 2016 Stabilization of Oncostatin-M mRNA by Binding of Nucleolin to a GC-Rich Element in Its 3'UTR.
26355153 2015 Fstl1 Promotes Asthmatic Airway Remodeling by Inducing Oncostatin M.
26311783 2015 Oncostatin M Confers Neuroprotection against Ischemic Stroke.
26304992 2015 Osteopontin Promotes Oncostatin M Production in Human Osteoblasts: Implication of Rheumatoid Arthritis Therapy.
26198770 2015 Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology.
25954856 2015 Oncostatin M activates STAT3 to promote endometrial cancer invasion and angiogenesis.
25849622 2015 Regulation of IL-17A responses in human airway smooth muscle cells by Oncostatin M.
25845347 2015 OSM is overexpressed in knee osteoarthritis and Notch signaling is involved in the effects of OSM on MC3T3-E1 cell proliferation and differentiation.
25840724 2015 Oncostatin M promotes mucosal epithelial barrier dysfunction, and its expression is increased in patients with eosinophilic mucosal disease.
25804939 2015 Bone Marrow Macrophages Contribute to Diabetic Stem Cell Mobilopathy by Producing Oncostatin M.
25735629 2015 Oncostatin M Promotes Osteoblastic Differentiation of Human Vascular Smooth Muscle Cells Through JAK3-STAT3 Pathway.
25252914 2014 Cancer-associated adipose tissue promotes breast cancer progression by paracrine oncostatin M and Jak/STAT3 signaling.
24710357 2014 Oncostatin M mediates STAT3-dependent intestinal epithelial restitution via increased cell proliferation, decreased apoptosis and upregulation of SERPIN family members.
24600984 2014 Relationship between serum oncostatin M levels and degree of coronary stenosis in patients with coronary artery disease.
24418171 2014 Characterization of the CD40L/Oncostatin M/Oncostatin M receptor axis as an antiviral and immunostimulatory system disrupted in chronic HCV infection.
24381786 2013 The enigmatic cytokine oncostatin m and roles in disease.
24297795 2014 Oncostatin m is produced in adipose tissue and is regulated in conditions of obesity and type 2 diabetes.
23867565 2013 Interleukin-6 and oncostatin-M synergize with the PI3K/AKT pathway to promote aggressive prostate malignancy in mouse and human tissues.
23735324 2013 Oncostatin M promotes mesenchymal stem cell-stimulated tumor growth through a paracrine mechanism involving periostin and TGFBI.
23621172 2013 Oncostatin M is a FIP1L1/PDGFRA-dependent mediator of cytokine production in chronic eosinophilic leukemia.
23584474 2014 Oncostatin-M promotes phenotypic changes associated with mesenchymal and stem cell-like differentiation in breast cancer.
23313749 2013 Involvement of IL-1 and oncostatin M in acanthosis associated with hypertensive leg ulcer.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22982441 2012 Oncostatin M is a growth factor for Ewing sarcoma.
22931588 2012 The effects of oncostatin M on trophoblast cells: influence on matrix metalloproteinases-2 and -9, and invasion activity.
22829597 2012 A unique loop structure in oncostatin M determines binding affinity toward oncostatin M receptor and leukemia inhibitory factor receptor.
22267707 2012 Oncostatin M suppresses oestrogen receptor-? expression and is associated with poor outcome in human breast cancer.
22267310 2012 Induction of osteogenesis in mesenchymal stem cells by activated monocytes/macrophages depends on oncostatin M signaling.
22056139 2011 Oncostatin M is a major mediator of cardiomyocyte dedifferentiation and remodeling.
22051730 2012 Identification of oncostatin M as a JAK2 V617F-dependent amplifier of cytokine production and bone marrow remodeling in myeloproliferative neoplasms.
21975934 2011 c-MYC functions as a molecular switch to alter the response of human mammary epithelial cells to oncostatin M.
21965736 2011 Oncostatin M and IL-6 induce u-PA and VEGF in prostate cancer cells and correlate in vivo.
21912637 2011 CNTF mediates neurotrophic factor secretion and fluid absorption in human retinal pigment epithelium.
21775705 2011 Endothelium-derived GM-CSF influences expression of oncostatin M.
21481226 2011 Oncostatin M promotes STAT3 activation, VEGF production, and invasion in osteosarcoma cell lines.
21457934 2011 Identification of oncostatin M as a STAT5-dependent mediator of bone marrow remodeling in KIT D816V-positive systemic mastocytosis.
21399864 2011 Oncostatin M promotes proliferation of ovarian cancer cells through signal transducer and activator of transcription 3.
21399633 2011 Genome-wide association study identifies susceptibility loci for IgA nephropathy.
21376322 2011 Oncostatin M is expressed in atherosclerotic lesions: a role for Oncostatin M in the pathogenesis of atherosclerosis.
21196532 2011 Janus kinase activation by cytokine oncostatin M decreases PCSK9 expression in liver cells.
20661773 2011 Helicobacter pylori induces expression and secretion of oncostatin M in macrophages in vitro.
20650266 2010 Oncostatin M up-regulates the ER chaperone Grp78/BiP in liver cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20626292 2010 Early differential expression of oncostatin M in obstructive nephropathy.
20408777 2010 Serum levels of oncostatin M (a gp 130 cytokine): an inflammatory biomarker in periodontal disease.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20189410 2010 Gingival crevicular fluid levels of oncostatin M in periodontal conditions.
20149034 2009 Oncostatin M as a target biological molecule of preeclampsia.
20101226 2010 S100A7 (psoriasin) is induced by the proinflammatory cytokines oncostatin-M and interleukin-6 in human breast cancer.
20088942 2010 The inflammatory mediator oncostatin M induces angiopoietin 2 expression in endothelial cells in vitro and in vivo.
19916861 2009 Oncostatin M (OSM) is increased in asthma with incompletely reversible airflow obstruction.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19652200 2009 Thrombin induces the expression of oncostatin M via AP-1 activation in human macrophages: a link between coagulation and inflammation.
19565514 2009 Induction of CCL13 expression in synovial fibroblasts highlights a significant role of oncostatin M in rheumatoid arthritis.
19342253 2009 Role of a LIF antagonist in LIF and OSM induced MMP-1, MMP-3, and TIMP-1 expression by primary articular chondrocytes.
19158344 2009 Oncostatin M pathway plays a major role in the renal acute phase response.
19158240 2009 Oncostatin M enhances the antiviral effects of type I interferon and activates immunostimulatory functions in liver epithelial cells.
19148539 2009 Molecular dissection of human oncostatin M-mediated signal transductions through site-directed mutagenesis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19019853 2009 The inflammatory mediator oncostatin M induces stromal derived factor-1 in human adult cardiac cells.
18981157 2008 Oncostatin M-induced and constitutive activation of the JAK2/STAT5/CIS pathway suppresses CCL1, but not CCL7 and CCL8, chemokine expression.
18772145 2008 Identification of proteins binding to E-Box/Ku86 sites and function of the tumor suppressor SAFB1 in transcriptional regulation of the human xanthine oxidoreductase gene.
18637848 2008 Immunohistochemical localization of oncostatin M in epithelialized apical periodontitis lesions.
18564531 2008 Expression of oncostatin M in chronic obstructive sialadenitis of the submandibular gland.
18499891 2008 Oncostatin M-mediated regulation of KIT-ligand-induced extracellular signal-regulated kinase signaling maintains hematopoietic repopulating activity of Lin-CD34+CD133+ cord blood cells.
18398932 2008 Monocyte-dependent oncostatin M and TNF-alpha synergize to stimulate unopposed matrix metalloproteinase-1/3 secretion from human lung fibroblasts in tuberculosis.
18317962 OSM, LIF, its receptors, and its relationship with the malignance in human breast carcinoma (in situ and in infiltrative).
18187666 2008 In human macrophages the complement component C5a induces the expression of oncostatin M via AP-1 activation.
18028996 2008 Human mast cells release oncostatin M on contact with activated T cells: possible biologic relevance.
17979974 2008 Interleukin-6 cytokine family member oncostatin M is a hair-follicle-expressed factor with hair growth inhibitory properties.
17881458 2007 Oncostatin M-induced effects on EMT in human proximal tubular cells: differential role of ERK signaling.
17761945 2007 Transcriptional activation of hepatic ACSL3 and ACSL5 by oncostatin m reduces hypertriglyceridemia through enhanced beta-oxidation.
17604327 2007 The inflammatory cytokine oncostatin M induces PAI-1 in human vascular smooth muscle cells in vitro via PI 3-kinase and ERK1/2-dependent pathways.
17471233 2007 Sensitization of osteosarcoma cells to apoptosis by oncostatin M depends on STAT5 and p53.
17372020 2007 Oncostatin M secreted by skin infiltrating T lymphocytes is a potent keratinocyte activator involved in skin inflammation.
17081797 2007 Oncostatin M decreases adiponectin expression and induces dedifferentiation of adipocytes by JAK3- and MEK-dependent pathways.
17028186 2006 Molecular and functional characterization of a soluble form of oncostatin M/interleukin-31 shared receptor.
17009243 2006 Oncostatin M induces angiogenesis and cartilage degradation in rheumatoid arthritis synovial tissue and human cartilage cocultures.
16802343 2006 Regulation of pre-B cell colony-enhancing factor by STAT-3-dependent interleukin-6 trans-signaling: implications in the pathogenesis of rheumatoid arthritis.
16713283 2006 Oncostatin M induces cell detachment and enhances the metastatic capacity of T-47D human breast carcinoma cells.
16369169 2005 Upregulation of oncostatin m in allergic rhinitis.
16051226 2005 The N-terminal cytokine binding domain of LIFR is required for CNTF binding and signaling.
15863389 2005 Measurement of gp130 cytokines oncostatin M and IL-6 in gingival crevicular fluid of patients with chronic periodontitis.
15837947 2005 Inflammatory cytokines interleukin-6 and oncostatin m induce plasminogen activator inhibitor-1 in human adipose tissue.
15831292 2005 Immunocytochemical detection and reverse transcription polymerase chain reaction expression of oncostatin M (OSM) and its receptor (OSM-Rbeta) in human fetal and adult ovaries.
15809742 2005 Oncostatin M signaling in human glioma cell lines.
15712220 2005 Interleukin-6 and oncostatin M stimulation of proliferation of prostate cancer 22Rv1 cells through the signaling pathways of p38 mitogen-activated protein kinase and phosphatidylinositol 3-kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15146412 2004 Secretion of oncostatin M by neutrophils in rheumatoid arthritis.
12707269 2003 Leukemia inhibitory factor (LIF), cardiotrophin-1, and oncostatin M share structural binding determinants in the immunoglobulin-like domain of LIF receptor.
12692260 2003 Induction of "antigen silencing" in melanomas by oncostatin M: down-modulation of melanocyte antigen expression.
12640208 2003 Increased production of oncostatin-M by lymphomononuclear cells from HIV-1-infected patients with neuroAIDS.
12531804 2003 Kaposi sarcoma-associated viral cyclin K overrides cell growth inhibition mediated by oncostatin M through STAT3 inhibition.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391243 2002 Secretion of oncostatin M by infiltrating neutrophils: regulation of IL-6 and chemokine expression in human mesothelial cells.
12218157 2002 IL-6, leukemia inhibitory factor, and oncostatin M stimulate bone resorption and regulate the expression of receptor activator of NF-kappa B ligand, osteoprotegerin, and receptor activator of NF-kappa B in mouse calvariae.
12138373 2002 Oncostatin M induces procoagulant activity in human vascular smooth muscle cells by modulating the balance between tissue factor and tissue factor pathway inhibitor.
12090757 2002 Oncostatin M induces tissue-type plasminogen activator and plasminogen activator inhibitor-1 in Calu-1 lung carcinoma cells.
12061841 2002 Oncostatin M production by human dendritic cells in response to bacterial products.
12061840 2002 Coexpression of oncostatin M and its receptors and evidence for STAT3 activation in human ovarian carcinomas.
11936950 2002 Oncostatin M induced alpha1-antitrypsin (AAT) gene expression in Hep G2 cells is mediated by a 3' enhancer.
11839742 2002 Identification of sterol-independent regulatory elements in the human ATP-binding cassette transporter A1 promoter: role of Sp1/3, E-box binding factors, and an oncostatin M-responsive element.
11818668 2002 Autocrine production and synergistic growth-promoting activity of interleukin-6 and oncostatin M in a new human myeloma cell line TU-1.
11811789 2001 Oncostatin M and leukemia inhibitory factor regulate the growth of normal human breast epithelial cells.
11777927 2002 Activation of signal transducer and activator of transcription 1 (STAT1) is not sufficient for the induction of STAT1-dependent genes in endothelial cells. Comparison of interferon-gamma and oncostatin M.
11711546 2002 Interstitial collagens I, III, and VI sequester and modulate the multifunctional cytokine oncostatin M.
10997905 2000 Crystal structure and functional dissection of the cytostatic cytokine oncostatin M.
10591208 1999 The DNA sequence of human chromosome 22.
10556323 1999 Cloning and characterization of human oncostatin M promoter.
9920829 1999 Reconstitution of the functional mouse oncostatin M (OSM) receptor: molecular cloning of the mouse OSM receptor beta subunit.
9847074 1998 Toward a complete human genome sequence.
8999038 1996 Dual oncostatin M (OSM) receptors. Cloning and characterization of an alternative signaling subunit conferring OSM-specific receptor activation.
8422753 1993 Localization of the human oncostatin M gene (OSM) to chromosome 22q12, distal to the Ewing's sarcoma breakpoint.
8406444 1993 The genes for oncostatin M (OSM) and leukemia inhibitory factor (LIF) are tightly linked on human chromosome 22.
7867561 1995 Inhibition of growth hormone-releasing factor production in mouse placenta by cytokines using gp130 as a signal transducer.
7508917 1994 Mitogen-activated protein kinases and ribosomal S6 protein kinases are involved in signaling pathways shared by interleukin-11, interleukin-6, leukemia inhibitory factor, and oncostatin M in mouse 3T3-L1 cells.
3540948 1986 Oncostatin M: a growth regulator produced by differentiated histiocytic lymphoma cells.
2779549 1989 Molecular cloning, sequence analysis, and functional expression of a novel growth regulator, oncostatin M.
2325640 1990 Cleavage of a hydrophilic C-terminal domain increases growth-inhibitory activity of oncostatin M.
2026606 1991 Disulfide bond assignment and identification of regions required for functional activity of oncostatin M.
1717982 1991 Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6.
1542794 1992 The IL-6 signal transducer, gp130: an oncostatin M receptor and affinity converter for the LIF receptor.
1542793 1992 Oncostatin M as a potent mitogen for AIDS-Kaposi's sarcoma-derived cells.
1542792 1992 Identification of a major growth factor for AIDS-Kaposi's sarcoma cells as oncostatin M.
1536831 1992 Oncostatin M binds the high-affinity leukemia inhibitory factor receptor.