Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
hepatocellular carcinoma -1.100 4.8e-05
malignant mesothelioma 1.300 5.7e-06
medulloblastoma, large-cell -1.100 3.6e-03
Multiple myeloma 1.050 2.6e-02
ovarian cancer 1.600 1.5e-06
tuberculosis and treatment for 6 months 1.100 6.9e-06

AA Sequence

MKSEAKDGEEESLQTAFKKLRVDASGSVASLSVGEGTGVRAPVRTATDDTKPKTTCASKDSWHGSTRKSS      1 - 70
RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSGLGISSPKEFSAGESSTSLDA     71 - 140
NHTGAVVEPLRTSVPRLPSESKKEDSSDATQVPQASLKASDLSDFQSVSKLNQGKPCTCIGKECQCKRWH    141 - 210
DMEVYSFSGLQSVPPLAPERRSTLEDYSQSLHARTLSGSPRSCSEQARVFVDDVTIEDLSGYMEYYLYIP    211 - 280
KKMSHMAEMMYT                                                              281 - 292
//

Text Mined References (9)

PMID Year Title