Property Summary

NCBI Gene PubMed Count 16
PubMed Score 22.16
PubTator Score 14.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Retinal disease 23 0.0 1.1
Disease Target Count Z-score Confidence
Nasopharynx carcinoma 18 4.277 2.1

Expression

Gene RIF (8)

AA Sequence

MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLNDIISTMFNRKFMEELFKPQE      1 - 70
LYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDTIKGFIRDSP     71 - 140
TILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRVSMFLKDKVQNNNGRFVLPVSGPVPWGT    141 - 210
EVPGLIRMFNNKGEEVKRIEFKHGGNYVPAPKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLAS    211 - 280
WTQESIAPNPLAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRPEELSYEVINIQAT    281 - 350
QDQQRSEELARIMGEFEITEQPRLSTSKGDDLLAMMDEL                                   351 - 389
//

Text Mined References (17)

PMID Year Title