Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.31
PubTator Score 3.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
medulloblastoma -3.000 7.4e-05
cystic fibrosis 2.303 3.8e-07
atypical teratoid / rhabdoid tumor -2.400 8.5e-04
glioblastoma -1.200 7.6e-03
medulloblastoma, large-cell -2.300 1.3e-05
Amyotrophic Lateral Sclerosis 1.336 4.2e-07
acute quadriplegic myopathy 1.972 3.8e-06
adrenocortical carcinoma 2.428 1.4e-04
lung adenocarcinoma -1.200 1.2e-12
subependymal giant cell astrocytoma 1.773 1.2e-02
nasopharyngeal carcinoma -1.300 3.7e-05
lung carcinoma -1.600 1.7e-10
ovarian cancer -1.900 6.9e-06
pituitary cancer 1.900 1.2e-07
chronic rhinosinusitis -1.848 9.4e-03

 GO Function (1)

 GO Process (1)

Gene RIF (3)

PMID Text
22190034 HIV-1 PR is identified to have a physical interaction with oxysterol binding protein-like 6 (OSBPL6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19401682 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of oxysterol binding protein-like 6 (OSBPL6) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MSSDEKGISPAHKTSTPTHRSASSSTSSQRDSRQSIHILERTASSSTEPSVSRQLLEPEPVPLSKEADSW      1 - 70
EIIEGLKIGQTNVQKPDKHEGFMLKKRKWPLKGWHKRFFVLDNGMLKYSKAPLDIQKGKVHGSIDVGLSV     71 - 140
MSIKKKARRIDLDTEEHIYHLKVKSQDWFDAWVSKLRHHRLYRQNEIVRSPRDASFHIFPSTSTAESSPA    141 - 210
ANVSVMDGKMQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVELSKLLQ    211 - 280
NLEILQRTQSAPNFTDMQANCVDISKKDKRVTRRWRTKSVSKDTKIQLQVPFSATMSPVRLHSSNPNLCA    281 - 350
DIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKVHSLLKSAFNSIAIEKEKLKQMVSEQDHSKGHSTQM    351 - 420
ARLRQSLSQALNQNAELRSRLNRIHSESIICDQVVSVNIIPSPDEAGEQIHVSLPLSQQVANESRLSMSE    421 - 490
SVSEFFDAQEVLLSASSSENEASDDESYISDVSDNISEDNTSVADNISRQILNGELTGGAFRNGRRACLP    491 - 560
APCPDTSNINLWNILRNNIGKDLSKVSMPVELNEPLNTLQHLCEEMEYSELLDKASETDDPYERMVLVAA    561 - 630
FAVSGYCSTYFRAGSKPFNPVLGETYECIREDKGFRFFSEQVSHHPPISACHCESKNFVFWQDIRWKNKF    631 - 700
WGKSMEILPVGTLNVMLPKYGDYYVWNKVTTCIHNILSGRRWIEHYGEVTIRNTKSSVCICKLTFVKVNY    701 - 770
WNSNMNEVQGVVIDQEGKAVYRLFGKWHEGLYCGVAPSAKCIWRPGSMPTNYELYYGFTRFAIELNELDP    771 - 840
VLKDLLPPTDARFRPDQRFLEEGNLEAAASEKQRVEELQRSRRRYMEENNLEHIPKFFKKVIDANQREAW    841 - 910
VSNDTYWELRKDPGFSKVDSPVLW                                                  911 - 934
//

Text Mined References (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23166209 2012 Impact of ancestry and common genetic variants on QT interval in African Americans.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22190034 2011 Global landscape of HIV-human protein complexes.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17428193 2007 The mammalian oxysterol-binding protein-related proteins (ORPs) bind 25-hydroxycholesterol in an evolutionarily conserved pocket.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14593528 2004 Subfamily III of mammalian oxysterol-binding protein (OSBP) homologues: the expression and intracellular localization of ORP3, ORP6, and ORP7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11735225 2001 A family of 12 human genes containing oxysterol-binding domains.
11483621 2001 The OSBP-related protein family in humans.
10588946 1999 Family of human oxysterol binding protein (OSBP) homologues. A novel member implicated in brain sterol metabolism.