Property Summary

NCBI Gene PubMed Count 24
PubMed Score 8.33
PubTator Score 10.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 8.6e-05
ovarian cancer 8491 2.5e-04
spina bifida 1064 4.0e-02

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.631 8.6e-05
spina bifida 1.083 4.0e-02
ovarian cancer 1.400 2.5e-04

Gene RIF (7)

PMID Text
26206935 ORP5 and ORP8 could mediate PI4P/phosphatidylserine (PS) countertransport between the endoplasmic reticulum (ER) and the plasma membrane (PM), thus delivering PI4P to the ER-localized PI4P phosphatase Sac1 for degradation and PS from the ER to the PM.
25963840 Results show that OSBPL5 and CALU were expressed at higher levels in the lung tissues of metastasis-positive cases than that in the metastasis-negative cases suggesting they can promote invasiveness of lung cancer cells.
21220512 ORP5 may cooperate with NPC1 to mediate the exit of cholesterol from endosomes/lysosomes.
20644730 Telomeric NAP1L4 and OSBPL5 of the KCNQ1 cluster, and the DECORIN gene are not imprinted in human trophoblast stem cells.
20201924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19032366 OSBPL5 is relatd to invasion and poor prognosis in pancreatic cancer.
12504849 OBPH1/Obph1 gene is imprinted, with preferential expression from the maternal allele in human and mouse.

AA Sequence

MKEEAFLRRRFSLCPPSSTPQKVDPRKLTRNLLLSGDNELYPLSPGKDMEPNGPSLPRDEGPPTPSSATK      1 - 70
VPPAEYRLCNGSDKECVSPTARVTKKETLKAQKENYRQEKKRATRQLLSALTDPSVVIMADSLKIRGTLK     71 - 140
SWTKLWCVLKPGVLLIYKTPKVGQWVGTVLLHCCELIERPSKKDGFCFKLFHPLDQSVWAVKGPKGESVG    141 - 210
SITQPLPSSYLIFRAASESDGRCWLDALELALRCSSLLRLGTCKPGRDGEPGTSPDASPSSLCGLPASAT    211 - 280
VHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEE    281 - 350
LGELGEASQVETVSEENKSLMWTLLKQLRPGMDLSRVVLPTFVLEPRSFLNKLSDYYYHADLLSRAAVEE    351 - 420
DAYSRMKLVLRWYLSGFYKKPKGIKKPYNPILGETFRCCWFHPQTDSRTFYIAEQVSHHPPVSAFHVSNR    421 - 490
KDGFCISGSITAKSRFYGNSLSALLDGKATLTFLNRAEDYTLTMPYAHCKGILYGTMTLELGGKVTIECA    491 - 560
KNNFQAQLEFKLKPFFGGSTSINQISGKITSGEEVLASLSGHWDRDVFIKEEGSGSSALFWTPSGEVRRQ    561 - 630
RLRQHTVPLEEQTELESERLWQHVTRAISKGDQHRATQEKFALEEAQRQRARERQESLMPWKPQLFHLDP    631 - 700
ITQEWHYRYEDHSPWDPLKDIAQFEQDGILRTLQQEAVARQTTFLGSPGPRHERSGPDQRLRKASDQPSG    701 - 770
HSQATESSGSTPESCPELSDEEQDGDFVPGGESPCPRCRKEARRLQALHEAILSIREAQQELHRHLSAML    771 - 840
SSTARAAQAPTPGLLQSPRSWFLLCVFLACQLFINHILK                                   841 - 879
//

Text Mined References (29)

PMID Year Title
26206935 2015 INTRACELLULAR TRANSPORT. PI4P/phosphatidylserine countertransport at ORP5- and ORP8-mediated ER-plasma membrane contacts.
25963840 2015 Identification and evaluation of metastasis-related proteins, oxysterol binding protein-like 5 and calumenin, in lung tumors.
23934110 2013 Interactome map uncovers phosphatidylserine transport by oxysterol-binding proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21220512 2011 A role for oxysterol-binding protein-related protein 5 in endosomal cholesterol trafficking.
20644730 2010 Telomeric NAP1L4 and OSBPL5 of the KCNQ1 cluster, and the DECORIN gene are not imprinted in human trophoblast stem cells.
20201924 2010 Genome-wide association study of alcohol dependence implicates a region on chromosome 11.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19032366 2008 Oxysterol binding protein-related protein-5 is related to invasion and poor prognosis in pancreatic cancer.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17428193 2007 The mammalian oxysterol-binding protein-related proteins (ORPs) bind 25-hydroxycholesterol in an evolutionarily conserved pocket.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12504849 2002 Characterization and imprinting status of OBPH1/Obph1 gene: implications for an extended imprinting domain in human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11735225 2001 A family of 12 human genes containing oxysterol-binding domains.
11483621 2001 The OSBP-related protein family in humans.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10588946 1999 Family of human oxysterol binding protein (OSBP) homologues. A novel member implicated in brain sterol metabolism.