Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.50
PubTator Score 5.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 1.200 2.2e-06
astrocytic glioma -2.000 1.3e-03
ependymoma -2.300 1.7e-03
oligodendroglioma -2.000 1.0e-03
group 4 medulloblastoma -2.400 3.3e-04
tuberculosis 1.400 3.5e-03
primary pancreatic ductal adenocarcinoma 1.672 3.1e-03
intraductal papillary-mucinous adenoma (... 1.800 8.7e-03
intraductal papillary-mucinous carcinoma... 2.000 2.8e-03
intraductal papillary-mucinous neoplasm ... 2.900 4.6e-03
lung cancer 1.300 2.3e-03
pancreatic cancer 1.800 6.4e-06
primary Sjogren syndrome 1.200 1.2e-02
nasopharyngeal carcinoma -1.200 7.9e-04
spina bifida -2.406 3.6e-02
invasive ductal carcinoma 1.100 9.3e-03
ovarian cancer 1.700 2.3e-03
pituitary cancer -2.400 1.9e-04

Gene RIF (8)

PMID Text
22906437 Data indicate that the apoB-100 secretion phenotype is replicated in HepG2 cells transduced with the ORP10 shRNA lentiviruses.
20610895 Single-nucleotide polymorphisms in OSBPL10 is associated with peripheral arterial disease.
20610895 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20224571 Overall, the rs2290532 (D254N) polymorphism in OSBPL10 may predispose individuals to hyper-LDL cholesterolemia.
20224571 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19554302 Analysis of variants in three genes encoding OSBP homologues in families with familial low high-density lipoprotein levels or familial combined hyperlipidemia revealed linkage of OSBPL10 single-nucleotide polymorphisms with high triglyceride trait.
19554302 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERAVQGTDGGGGSNSSSRSSSRATSAGSSPSCSLAGRGVSSRSAAAGLGGGGSRSSPGSVAASPSGGGG      1 - 70
RRREPALEGVLSKYTNLLQGWQNRYFVLDFEAGILQYFVNEQSKHQKPRGVLSLSGAIVSLSDEAPHMLV     71 - 140
VYSANGEMFKLRAADAKEKQFWVTQLRACAKYHMEMNSKSAPSSRSRSLTLLPHGTPNSASPCSQRHLSV    141 - 210
GAPGVVTITHHKSPAAARRAKSQYSGQLHEVREMMNQVEGQQKNLVHAIESLPGSGPLTALDQDLLLLKA    211 - 280
TSAATLSCLGECLNLLQQSVHQAGQPSQKPGASENILGWHGSKSHSTEQLKNGTLGSLPSASANITWAIL    281 - 350
PNSAEDEQTSQPEPEPNSGSELVLSEDEKSDNEDKEETELGVMEDQRSIILHLISQLKLGMDLTKVVLPT    351 - 420
FILEKRSLLEMYADFMAHPDLLLAITAGATPEERVICFVEYYLTAFHEGRKGALAKKPYNPIIGETFHCS    421 - 490
WEVPKDRVKPKRTASRSPASCHEHPMADDPSKSYKLRFVAEQVSHHPPISCFYCECEEKRLCVNTHVWTK    491 - 560
SKFMGMSVGVSMIGEGVLRLLEHGEEYVFTLPSAYARSILTIPWVELGGKVSINCAKTGYSATVIFHTKP    561 - 630
FYGGKVHRVTAEVKHNPTNTIVCKAHGEWNGTLEFTYNNGETKVIDTTTLPVYPKKIRPLEKQGPMESRN    631 - 700
LWREVTRYLRLGDIDAATEQKRHLEEKQRVEERKRENLRTPWKPKYFIQEGDGWVYFNPLWKAH          701 - 764
//

Text Mined References (25)

PMID Year Title
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24281739 2014 Is the gene-environment interaction paradigm relevant to genome-wide studies? The case of education and body mass index.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23934110 2013 Interactome map uncovers phosphatidylserine transport by oxysterol-binding proteins.
23325789 2013 cAMP-stimulated phosphorylation of diaphanous 1 regulates protein stability and interaction with binding partners in adrenocortical cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22906437 2012 ORP10, a cholesterol binding protein associated with microtubules, regulates apolipoprotein B-100 secretion.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20610895 2010 Identification of evidence suggestive of an association with peripheral arterial disease at the OSBPL10 locus by genome-wide investigation in the Japanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20224571 2010 Variation in OSBPL10 is associated with dyslipidemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19554302 2009 OSBPL10, a novel candidate gene for high triglyceride trait in dyslipidemic Finnish subjects, regulates cellular lipid metabolism.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17428193 2007 The mammalian oxysterol-binding protein-related proteins (ORPs) bind 25-hydroxycholesterol in an evolutionarily conserved pocket.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11735225 2001 A family of 12 human genes containing oxysterol-binding domains.
11483621 2001 The OSBP-related protein family in humans.