Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.48
PubTator Score 3.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.200 1.1e-03
intraductal papillary-mucinous adenoma (... 1.500 3.8e-04
osteosarcoma 4.053 1.0e-08
ovarian cancer -1.200 2.6e-03
tuberculosis 1.100 1.4e-04

Gene RIF (4)

AA Sequence

MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNIIHNLGMYVFLHAVKGT      1 - 70
PFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTHFILNTASLLSVLIPKMP     71 - 140
QLHGVRIFGINKY                                                             141 - 153
//

Text Mined References (18)

PMID Year Title