Property Summary

NCBI Gene PubMed Count 37
PubMed Score 78.13
PubTator Score 48.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.885 7.0e-06
intraductal papillary-mucinous adenoma (... 2.600 2.4e-03
psoriasis 1.500 2.3e-04

Gene RIF (22)

PMID Text
25965830 Low ORM2 expression is associated with metastasis in hepatocellular carcinoma.
25408356 Data indicate that the band intensity of sialic acid content in alpha-1 Acid glycoprotein (AGP) of alcoholic liver cirrhosis was found to be lower than that in pooled control group.
24389491 These findings suggest that the ORM distal promoter region differentially regulates expression of ORM genes at basal level and in acute phase responses.
24359035 Data suggest that human serum albumin (HSA) might serve as a carrier in delivering chitooligomers to target tissues than alpha-1-glycoprotein (AGP) which has pharmacological importance.
23867815 AGP inhibits the binding of the HIV-1 gp120 consensus V3 domain (V3Cs) and macrophage inflammatory protein-1beta (MIP-1beta) to CCR5 on human monocyte-derived macrophages (MDM)
22363757 Alteration in expression of ORM2 suggests that ORM2 could be used as a potential biomarker in the diagnosis of colorectal cancer.
21638284 Identify ORM genetic variations/haplotype structure associated with serum alpha-1-acid glycoprotein level and the pharmacokinetics of paclitaxel in Japanese cancer patients.
20617306 Characterized are more than 150 human Alpha-1-acid glycoprotein isoforms, differing both in the amino acid sequence and in the glycosylation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19958090 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19584153 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19018521 The results indicate that, in accordance with prior expectations, the ORM2 variant is responsible for the acute-phase property of alpha-1 acid glycoprotein.
17987628 A different distribution of the area percentage of AGP forms is observed when comparing samples from diseased and healthy individuals, the most acidic AGP forms being present in a higher proportion in the samples from cancer patients.
17048007 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16331959 Results describe the thermal unfolding and reversibility of temperature-induced changes in alpha(1)-acid glycoprotein.
16290938 The binding of coumarin enantiomers to ORM2 is studied.
15863355 the sera of patients with acute inflammation demonstrated increased numbers of bi-antennary and alpha1,3-fucosylated N-glycan structures at each glycosylation site
12480518 folds as a highly symmetrical all-beta protein dominated by a single eight-stranded antiparallel beta-sheet
11587070 structure of the alpha1-acid glycoprotein (AGP), or orosomucoid (ORM), gene was investigated in a Ghanaian mother and her child, who shared an unusual variant, ORM1 S2(C), found by isoelectric focusing
11336643 AGP inhibits the binding of the HIV-1 gp120 consensus V3 domain (V3Cs) and macrophage inflammatory protein-1beta (MIP-1beta) to CCR5 on human monocyte-derived macrophages (MDM)
9455924 AGP inhibits the binding of the HIV-1 gp120 consensus V3 domain (V3Cs) and macrophage inflammatory protein-1beta (MIP-1beta) to CCR5 on human monocyte-derived macrophages (MDM)
7795416 AGP inhibits the binding of the HIV-1 gp120 consensus V3 domain (V3Cs) and macrophage inflammatory protein-1beta (MIP-1beta) to CCR5 on human monocyte-derived macrophages (MDM)

AA Sequence

MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFT      1 - 70
PNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNW     71 - 140
GLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES             141 - 201
//

Text Mined References (43)

PMID Year Title
25965830 2015 Orosomucoid 2 inhibits tumor metastasis and is upregulated by CCAAT/enhancer binding protein ? in hepatocellular carcinomas.
25408356 2015 Structural heterogeneity of glycoform of alpha-1 Acid glycoprotein in alcoholic cirrhosis patients.
24389491 2014 Distal promoter regions are responsible for differential regulation of human orosomucoid-1 and -2 gene expression and acute phase responses.
24359035 2015 Differential interactions and structural stability of chitosan oligomers with human serum albumin and ?-1-glycoprotein.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22363757 2012 The potential role of ORM2 in the development of colorectal cancer.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21638284 2011 Genetic variations of orosomucoid genes associated with serum alpha-1-acid glycoprotein level and the pharmacokinetics of paclitaxel in Japanese cancer patients.
21349832 2011 Structural insights into differences in drug-binding selectivity between two forms of human alpha1-acid glycoprotein genetic variants, the A and F1*S forms.
20617306 2010 Isoform differentiation of intact AGP from human serum by capillary electrophoresis-mass spectrometry.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19958090 2009 Genetic determinants of warfarin dosing in the Han-Chinese population.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19584153 2009 Clinical relevance of a pharmacogenetic approach using multiple candidate genes to predict response and resistance to imatinib therapy in chronic myeloid leukemia.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19018521 2009 Investigation of genetic variants of alpha-1 acid glycoprotein by ultra-performance liquid chromatography-mass spectrometry.
17987628 2007 Comparison of alpha-1-acid glycoprotein isoforms from healthy and cancer patients by capillary IEF.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17048007 2007 Association of warfarin dose with genes involved in its action and metabolism.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16331959 2005 Temperature-induced molten globule-like state in human alpha1-acid glycoprotein: an infrared spectroscopic study.
16290938 2006 Selective binding of coumarin enantiomers to human alpha1-acid glycoprotein genetic variants.
15863355 2005 Glycosylation of site-specific glycans of alpha1-acid glycoprotein and alterations in acute and chronic inflammation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15253437 A new strategy for identification of N-glycosylated proteins and unambiguous assignment of their glycosylation sites using HILIC enrichment and partial deglycosylation.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15084671 2004 A proteomic analysis of human bile.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12528117 2003 Increased salivary gland tissue expression of Fas, Fas ligand, cytotoxic T lymphocyte-associated antigen 4, and programmed cell death 1 in primary Sjögren's syndrome.
12480518 2003 Structure of human alpha1-acid glycoprotein and its high-affinity binding site.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11587070 2001 Characterization of genomic rearrangements of the alpha1-acid glycoprotein/orosomucoid gene in Ghanaians.
4711474 1973 Structure of 1 -acid glycoprotein. The complete amino acid sequence, multiple amino acid substitutions, and homology with the immunoglobulins.
4603214 1974 The disulfide bonds of alpha1-acid glycoprotein.
3679210 1987 Orosomucoid (ORM) typing by isoelectric focusing: evidence for gene duplication of ORM1 and genetic polymorphism of ORM2.
3631077 1987 Genetic studies of low-abundance human plasma proteins. V. Evidence for a second orosomucoid structural locus (ORM2) expressed in plasma.
2970990 1988 Structure and characterisation of a duplicated human alpha 1 acid glycoprotein gene.
2822385 1987 Structure and expression of the genes coding for human alpha 1-acid glycoprotein.
1567356 1992 Analysis of the five glycosylation sites of human alpha 1-acid glycoprotein.