Property Summary

NCBI Gene PubMed Count 40
PubMed Score 85.03
PubTator Score 48.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 2.600 2.4e-03
osteosarcoma -2.885 7.0e-06
psoriasis 1.500 2.3e-04

Gene RIF (23)

AA Sequence

MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFT      1 - 70
PNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNW     71 - 140
GLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES             141 - 201
//

Text Mined References (46)

PMID Year Title