Property Summary

NCBI Gene PubMed Count 37
PubMed Score 26.30
PubTator Score 16.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Meier-Gorlin syndrome 10 7.273 3.6
Disease Target Count
MEIER-GORLIN SYNDROME 3 1

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.621 1.3e-06
Breast cancer 2.400 4.1e-02
colon cancer 1.400 1.0e-05
ductal carcinoma in situ 1.300 4.1e-03
group 3 medulloblastoma 1.100 6.6e-03
intraductal papillary-mucinous carcinoma... 1.800 2.1e-04
intraductal papillary-mucinous neoplasm ... 2.300 1.9e-04
invasive ductal carcinoma 1.700 1.9e-03
lung adenocarcinoma 1.100 1.4e-03
lung cancer 1.600 6.0e-04
malignant mesothelioma 1.200 2.1e-06
non-small cell lung cancer 1.174 1.7e-19
psoriasis 1.300 2.5e-78

 MGI Phenotype (1)

Protein-protein Interaction (7)

Gene RIF (11)

AA Sequence

MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIK      1 - 70
LSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKSYESSLPQTQQVDLDLSRPLF     71 - 140
TSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAK    141 - 210
EMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE                                211 - 252
//

Text Mined References (43)

PMID Year Title