Property Summary

NCBI Gene PubMed Count 34
PubMed Score 31.31
PubTator Score 12.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma 1.197 6.3e-06
dermatomyositis 1.200 2.6e-03
group 3 medulloblastoma 1.100 4.1e-03
lung cancer 1.700 7.4e-03
Multiple myeloma 1.000 3.2e-02
non-small cell lung cancer 1.098 3.1e-15
ovarian cancer 1.600 5.0e-04
Pick disease -1.200 2.8e-03
psoriasis -1.200 1.1e-03
tuberculosis and treatment for 6 months -1.100 7.6e-04

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVFVNCVECFTLR      1 - 70
LLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTVYIVLDKAEYLRDMEANLLPG     71 - 140
FLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFPDYSIGNLQKILSHDHPPEYSADFYAAYINI    141 - 210
LLGVFYTVCRDLKELRHLAVLNFPKYCEPVVKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEK    211 - 280
LQKDDTDPGQLKGLSAHTHVELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNH    281 - 350
LLGPKPFPLDRLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIA    351 - 420
RTVNFDIIKYLYDFL                                                           421 - 435
//

Text Mined References (36)

PMID Year Title