Property Summary

NCBI Gene PubMed Count 56
PubMed Score 3.38
PubTator Score 46.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.200 1.5e-04
psoriasis -1.700 2.6e-04
osteosarcoma -2.008 2.5e-07
group 3 medulloblastoma 1.400 4.2e-05
glioblastoma -1.100 6.3e-04
medulloblastoma, large-cell 1.100 2.9e-04
intraductal papillary-mucinous adenoma (... 1.400 8.7e-03
intraductal papillary-mucinous carcinoma... 1.300 2.1e-02
lung cancer 1.600 3.0e-03
ovarian cancer -1.700 5.8e-08

Gene RIF (12)

PMID Text
24792176 Protein phosphatase 1 dephosphorylates Orc2 to promote the binding of ORC to chromatin and replication origins for the subsequent round of the cell cycle.
24732362 These results suggest that PP1 dephosphorylates Orc2 to promote the binding of ORC to chromatin.
23188630 Gemcitabine resistance is dependent on Plk1-mediated phosphorylation of Orc2 and Hbo1.
22935713 Orc2 protects ORCA from ubiquitin-mediated degradation in vivo.
22334659 The phosphorylation of ORC2 dissociates origin recognition complex (ORC) from chromatin and replication origins and inhibits binding of ORC to newly replicated DNA.
21947279 Plk1 phosphorylation of Orc2 promotes DNA replication under conditions of stress
16762929 human Orc2 has specific domains that are required in vivo for assembly and nuclear localization of the origin recognition complex
16407251 The low level of Orc2 in Orc2 hypomorphic cells hinders normal cell cycle progression by delaying the activation of G1 cyclin-dependent kinases.
15910003 Study using HCT116 haplo-insufficient cells and Orc2 hypomorphic cells demonstrates that human Ku80 and Orc2 bind to replication origins independently of each other.
12912926 The precise nucleotide of binding for ORC2 was identified near the stgart site for leading-strand synthesis; the transition to the post-replicative complex is accompanied by a 17 bp displacement of ORC2 towards the start site.
12897055 the human origin recognition complex has a role in sequence-independent DNA binding and replication initiation
11779870 ORC2 physically interacts with ORC1 on non-chromatin nuclear structures

AA Sequence

MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNY      1 - 70
VEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAKLASELAKTPQKSVSFSLKNDPEITINVPQSSK     71 - 140
GHSASDKVQPKNNDKSEFLSTAPRSLRKRLIVPRSHSDSESEYSASNSEDDEGVAQEHEEDTNAVIFSQK    141 - 210
IQAQNRVVSAPVGKETPSKRMKRDKTSDLVEEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVS    211 - 280
PSFSAELKQLNQQYEKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKS    281 - 350
VLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYL    351 - 420
IASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHVLRSLTPNARG    421 - 490
IFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIP    491 - 560
VDNGTLTDFLEKEEEEA                                                         561 - 577
//

Text Mined References (65)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24989122 2014 A role for DNA polymerase ? in the timing of DNA replication.
24792176 2014 Dephosphorylation of Orc2 by protein phosphatase 1 promotes the binding of the origin recognition complex to chromatin.
24732362 2014 Protein phosphatase 1 dephosphorylates Orc2.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23188630 2013 Plk1 phosphorylation of orc2 and hbo1 contributes to gemcitabine resistance in pancreatic cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22935713 2012 Orc2 protects ORCA from ubiquitin-mediated degradation.
22645314 2012 Dynamic association of ORCA with prereplicative complex components regulates DNA replication initiation.
22427655 2012 Leucine-rich repeat and WD repeat-containing protein 1 is recruited to pericentric heterochromatin by trimethylated lysine 9 of histone H3 and maintains heterochromatin silencing.
22334659 2012 Phosphorylation of ORC2 protein dissociates origin recognition complex from chromatin and replication origins.
21947279 2011 Plk1 phosphorylation of Orc2 promotes DNA replication under conditions of stress.
21269460 2011 Initial characterization of the human central proteome.
21029866 2010 Nucleosome-interacting proteins regulated by DNA and histone methylation.
20932478 2010 A WD-repeat protein stabilizes ORC binding to chromatin.
20467437 2010 Direct interaction between hnRNP-M and CDC5L/PLRG1 proteins affects alternative splice site choice.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19135898 2009 Purification of proteins associated with specific genomic Loci.
18946490 2008 RNA-dependent recruitment of the origin recognition complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18001825 2007 RNF8 transduces the DNA-damage signal via histone ubiquitylation and checkpoint protein assembly.
17716973 2007 ATP-dependent assembly of the human origin recognition complex.
16799465 2006 ORC binding to TRF2 stimulates OriP replication.
16762929 2006 Genetic analysis of human Orc2 reveals specific domains that are required in vivo for assembly and nuclear localization of the origin recognition complex.
16407251 2006 Proliferating human cells hypomorphic for origin recognition complex 2 and pre-replicative complex formation have a defect in p53 activation and Cdk2 kinase activation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15910003 2005 Ku80 binds to human replication origins prior to the assembly of the ORC complex.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15707391 2005 DNA-dependent phosphorylation of Chk1 and Claspin in a human cell-free system.
15684404 2005 Involvement of human MCM8 in prereplication complex assembly by recruiting hcdc6 to chromatin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15232106 2004 Self-assembling protein microarrays.
15226314 2004 Human claspin is a ring-shaped DNA-binding protein with high affinity to branched DNA structures.
15215892 2004 Human Orc2 localizes to centrosomes, centromeres and heterochromatin during chromosome inheritance.
12912926 2003 Localization of proteins bound to a replication origin of human DNA along the cell cycle.
12909626 2003 The ORC1 cycle in human cells: II. Dynamic changes in the human ORC complex during the cell cycle.
12897055 2003 Sequence-independent DNA binding and replication initiation by the human origin recognition complex.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12614612 2003 Interaction and assembly of murine pre-replicative complex proteins in yeast and mouse cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393188 2002 Ku antigen, an origin-specific binding protein that associates with replication proteins, is required for mammalian DNA replication.
12364596 2002 Human Mcm proteins at a replication origin during the G1 to S phase transition.
12045100 2002 DNA replication in eukaryotic cells.
11931757 2002 Human origin recognition complex large subunit is degraded by ubiquitin-mediated proteolysis after initiation of DNA replication.
11779870 2002 Nuclear organization of DNA replication initiation proteins in mammalian cells.
11602595 2001 Cell cycle-dependent proteolysis and phosphorylation of human Mcm10.
11509178 2001 Replication from oriP of Epstein-Barr virus requires human ORC and is inhibited by geminin.
11395502 2001 Architecture of the human origin recognition complex.
11323433 2001 Assembly of the human origin recognition complex.
11125146 2000 Inhibition of eukaryotic DNA replication by geminin binding to Cdt1.
11095689 2000 The human homolog of Saccharomyces cerevisiae Mcm10 interacts with replication factors and dissociates from nuclease-resistant nuclear structures in G(2) phase.
10954718 2000 Subsets of human origin recognition complex (ORC) subunits are expressed in non-proliferating cells and associate with non-ORC proteins.
10835370 2000 Selective instability of Orc1 protein accounts for the absence of functional origin recognition complexes during the M-G(1) transition in mammals.
10523313 1999 Mammalian Cdc7-Dbf4 protein kinase complex is essential for initiation of DNA replication.
10436018 1999 The Cdc6 nucleotide-binding site regulates its activity in DNA replication in human cells.
10402192 1999 latheo encodes a subunit of the origin recognition complex and disrupts neuronal proliferation and adult olfactory memory when mutant.
9765232 1998 ORC5L, a new member of the human origin recognition complex, is deleted in uterine leiomyomas and malignant myeloid diseases.
9733749 1998 Human minichromosome maintenance proteins and human origin recognition complex 2 protein on chromatin.
9660782 1998 The human homolog of Saccharomyces cerevisiae CDC45.
9353276 1997 Identification of HsORC4, a member of the human origin of replication recognition complex.
8808289 1996 Mouse and human homologues of the yeast origin of replication recognition complex subunit ORC2 and chromosomal localization of the cognate human gene ORC2L.
7502077 1995 Conserved initiator proteins in eukaryotes.