Property Summary

NCBI Gene PubMed Count 29
PubMed Score 34.13
PubTator Score 35.41

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BRQ5 Q96BI8
Symbols TMEM142C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (22)

PMID Text
26445441 Overall high Orai3/Orai1 ratios in human prostate epithelial cells and androgen-insensitive cancer cells contribute to their ROS resistance and thereby may have a share in making the prostate one of the most prominent cancer susceptible organs
25791427 Orai3 down-tunes efficient STIM1 gating when in a heteromeric complex with Orai1.
24954132 Suggest disrupted dynamic equilibrium of channel-forming ORAI proteins as an oncogenic mechanism in prostate cancer.
24909327 A channel chimera of Orai3 with the N terminus of Orai1 was able to couple local Ca(2+) entry to NFAT activation, identifying the N-terminal domain of Orai1 as central to Ca(2+) nanodomain-transcription coupling.
24603752 The higher amplitude of store-operated Ca2+ entry was associated to the over-expression for Stim2, Orai2-3, and TRPC1 while Stim2 levels remained constant and Stim1, Orai1, Orai3, TRPC1 and TRPC4 proteins were over-expressed in primary myelofibrosis.
24321771 Orai1 and Orai3 proteins are more important than calcium influx to control cell proliferation.
24058448 Orai3 constitutes a native store-operated calcium entry pathway in non small cell lung adenocarcinoma that controls cell proliferation and cell cycle progression, likely via Akt pathway.
23266555 High ORAI3 expression is associated with breast cancer.
22993197 data establish Orai3 as an ERalpha-regulated channel and a potential selective therapeutic target for ERalpha(+) breast cancers
21724845 the N-terminal conserved region plays a multifaceted role in Orai3 current gating with distinct structural requirements for STIM1- and 2-APB-stimulated activation.
20683915 Results provide strong evidence for a significant effect of Orai3 on breast cancer cell growth in vitro and show that this effect is associated with the induction of cell cycle and apoptosis resistance.
20607548 With these data we show a new Ca(2)(+) entry pathway linked to the Ca(2)(+)/inositolphosphate second-messenger system in RPE cells which help to further understand regulatory pathways of agonists.
20395295 there is a selective requirement for Orai3 versus Orai1 in estrogen receptor-positive versus estrogen receptor-negative breast cancer cells
20354224 differential redox sensitivity of ORAI1 and ORAI3 channels depends mainly on an extracellularly located reactive cysteine, which is absent in ORAI3
19887627 Heteromeric Orai1/3 protein assembly provides a concept for less Ca(2+)-selective store-operated channels.
19706554 Data show that the fast Ca(2+)-dependent inactivation is mediated by three conserved glutamates in the C termini (CT) of Orai2 and Orai3, which show prominent fast Ca(2+)-dependent inactivation compared with Orai1.
19506081 analysis of activation of Orai1-3 channels by a STIM1 coiled-coil mutant
18499656 stimulation of Orai3 currents by 2-aminoethoxydiphenyl borate occurred along with an alteration of the permeation pathway that represents a unique mechanism for regulating ion channel selectivity by chemical compounds
18420579 analysis of store-dependent and -independent modes regulating Ca2+ release-activated Ca2+ channel activity of human Orai1 and Orai3
18403424 The effects of 2-aminoethoxydiphenyl borate on orai1, orai2, orai3 metabolism in HEK293 cells with and without STIM1 are reported.
17991693 Expression of a dominant-negative mutant Orai3, either alone or in cells expressing wild-type Orai1, profoundly and specifically reduces currents through the ARC channels without affecting those through the CRAC channels.
17452328 Results suggest that Orai1, -2, and -3 channels are similarly inhibited by extracellular calcium, indicating similar affinities for Ca(2+) within the selectivity filter.

AA Sequence

MKGGEGDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAKLKASSRTSAL      1 - 70
LSGFAMVAMVEVQLESDHEYPPGLLVAFSACTTVLVAVHLFALMVSTCLLPHIEAVSNIHNLNSVHQSPH     71 - 140
QRLHRYVELAWGFSTALGTFLFLAEVVLVGWVKFVPIGAPLDTPTPMVPTSRVPGTLAPVATSLSPASNL    141 - 210
PRSSASAAPSQAEPACPPRQACGGGGAHGPGWQAAMASTAIMVPVGLVFVAFALHFYRSLVAHKTDRYKQ    211 - 280
ELEELNRLQGELQAV                                                           281 - 295
//

Text Mined References (29)

PMID Year Title
26956485 2016 A calcium-redox feedback loop controls human monocyte immune responses: The role of ORAI Ca2+ channels.
26718630 2016 Orai channel-mediated Ca2+ signals in vascular and airway smooth muscle.
26445441 2015 Differential Redox Regulation of Ca²? Signaling and Viability in Normal and Malignant Prostate Cells.
25791427 2015 Facilitation of Orai3 targeting and store-operated function by Orai1.
24954132 2014 Remodeling of channel-forming ORAI proteins determines an oncogenic switch in prostate cancer.
24909327 2014 Dynamic assembly of a membrane signaling complex enables selective activation of NFAT by Orai1.
24603752 2014 Enhanced expression of Stim, Orai, and TRPC transcripts and proteins in endothelial progenitor cells isolated from patients with primary myelofibrosis.
24321771 2014 Are Orai1 and Orai3 channels more important than calcium influx for cell proliferation?
24058448 2013 Orai3 constitutes a native store-operated calcium entry that regulates non small cell lung adenocarcinoma cell proliferation.
23890118 2013 The neglected CRAC proteins: Orai2, Orai3, and STIM2.
23266555 2013 ORAI3 silencing alters cell proliferation and cell cycle progression via c-myc pathway in breast cancer cells.
22993197 2013 Orai3 is an estrogen receptor ?-regulated Ca²? channel that promotes tumorigenesis.
21724845 2011 Molecular determinants within N terminus of Orai3 protein that control channel activation and gating.
20683915 2011 Down-regulation of Orai3 arrests cell-cycle progression and induces apoptosis in breast cancer cells but not in normal breast epithelial cells.
20607548 2011 Expression of Orai genes and I(CRAC) activation in the human retinal pigment epithelium.
20418871 2010 A novel EF-hand protein, CRACR2A, is a cytosolic Ca2+ sensor that stabilizes CRAC channels in T cells.
20395295 2010 A novel native store-operated calcium channel encoded by Orai3: selective requirement of Orai3 versus Orai1 in estrogen receptor-positive versus estrogen receptor-negative breast cancer cells.
20354224 2010 Differential redox regulation of ORAI ion channels: a mechanism to tune cellular calcium signaling.
19887627 2009 Plasticity in Ca2+ selectivity of Orai1/Orai3 heteromeric channel.
19706554 2009 Molecular determinants of fast Ca2+-dependent inactivation and gating of the Orai channels.
19506081 2009 Molecular determinants of the coupling between STIM1 and Orai channels: differential activation of Orai1-3 channels by a STIM1 coiled-coil mutant.
18499656 2008 2-aminoethoxydiphenyl borate alters selectivity of Orai3 channels by increasing their pore size.
18420579 2008 Store-dependent and -independent modes regulating Ca2+ release-activated Ca2+ channel activity of human Orai1 and Orai3.
18403424 2008 2-Aminoethoxydiphenyl borate directly facilitates and indirectly inhibits STIM1-dependent gating of CRAC channels.
17991693 2008 Both Orai1 and Orai3 are essential components of the arachidonate-regulated Ca2+-selective (ARC) channels.
17452328 2007 Calcium inhibition and calcium potentiation of Orai1, Orai2, and Orai3 calcium release-activated calcium channels.
16582901 2006 A mutation in Orai1 causes immune deficiency by abrogating CRAC channel function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.