Property Summary

NCBI Gene PubMed Count 29
PubMed Score 36.62
PubTator Score 35.41

Knowledge Summary

Patent

No data available

Expression

Gene RIF (23)

AA Sequence

MKGGEGDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAKLKASSRTSAL      1 - 70
LSGFAMVAMVEVQLESDHEYPPGLLVAFSACTTVLVAVHLFALMVSTCLLPHIEAVSNIHNLNSVHQSPH     71 - 140
QRLHRYVELAWGFSTALGTFLFLAEVVLVGWVKFVPIGAPLDTPTPMVPTSRVPGTLAPVATSLSPASNL    141 - 210
PRSSASAAPSQAEPACPPRQACGGGGAHGPGWQAAMASTAIMVPVGLVFVAFALHFYRSLVAHKTDRYKQ    211 - 280
ELEELNRLQGELQAV                                                           281 - 295
//

Text Mined References (29)

PMID Year Title