Property Summary

NCBI Gene PubMed Count 23
PubMed Score 13.06
PubTator Score 13.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.400 7.9e-03
atypical teratoid / rhabdoid tumor -1.100 1.3e-02
ependymoma 1.500 9.5e-03
glioblastoma 1.700 3.5e-04
group 4 medulloblastoma 1.100 1.6e-02
interstitial cystitis 1.800 1.0e-03
medulloblastoma, large-cell -1.800 6.9e-03
oligodendroglioma 1.200 9.9e-03
osteosarcoma 2.106 1.5e-09
ovarian cancer -2.200 3.1e-06
pediatric high grade glioma 1.100 1.2e-03
Pick disease 1.500 2.8e-07
progressive supranuclear palsy 1.200 3.0e-03
psoriasis -1.700 6.3e-04
ulcerative colitis 1.200 3.6e-06

Gene RIF (11)

AA Sequence

MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSRAKLKASSRTSALL      1 - 70
SGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTCILPNVEAVSNIHNLNSISESPHE     71 - 140
RMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQAALVSTIIMVPVGLI    141 - 210
FVVFTIHFYRSLVRHKTERHNREIEELHKLKVQLDGHERSLQVL                              211 - 254
//

Text Mined References (23)

PMID Year Title