Property Summary

NCBI Gene PubMed Count 21
PubMed Score 11.20
PubTator Score 13.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.400 7.9e-03
ependymoma 1.500 9.5e-03
oligodendroglioma 1.200 9.9e-03
psoriasis -1.700 6.3e-04
osteosarcoma -2.467 9.5e-09
atypical teratoid / rhabdoid tumor -1.100 1.3e-02
glioblastoma 1.700 3.5e-04
medulloblastoma, large-cell -1.800 6.9e-03
interstitial cystitis 1.800 1.0e-03
pediatric high grade glioma 1.100 1.2e-03
group 4 medulloblastoma 1.100 1.6e-02
Pick disease 1.500 2.8e-07
progressive supranuclear palsy 1.200 3.0e-03
ulcerative colitis 1.200 3.6e-06
ovarian cancer -2.200 3.1e-06

Synonym

Accession Q96SN7 Q6IA68 Q8WY94 Q9H9Y3
Symbols CBCIP2
C7orf19
MEM142B
TMEM142B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

PMID Text
25769459 Orai1, Orai2 and STIM1 form functional Ca(2+) release-activated Ca(2+) channels in OUMS-27 cells (chondrocytes) and that these complexes are responsible for sustained Ca(2+) entry in response to agonist stimulation.
24603752 The higher amplitude of store-operated Ca2+ entry was associated to the over-expression for Stim2, Orai2-3, and TRPC1 while Stim2 levels remained constant and Stim1, Orai1, Orai3, TRPC1 and TRPC4 proteins were over-expressed in primary myelofibrosis.
24040356 Orai1 but not Orai2 plays a major role in the influx of extracellular Ca2+ into and mediator release from HLMCs following their activation
22640869 Orai1 and Orai2 operate in a STIM-dependent manner, Orai3 does not interact with STIM isoforms upon calcium store depletion in platelets.
20607548 With these data we show a new Ca(2)(+) entry pathway linked to the Ca(2)(+)/inositolphosphate second-messenger system in RPE cells which help to further understand regulatory pathways of agonists.
19706554 Data show that the fast Ca(2+)-dependent inactivation is mediated by three conserved glutamates in the C termini (CT) of Orai2 and Orai3, which show prominent fast Ca(2+)-dependent inactivation compared with Orai1.
19506081 analysis of activation of Orai1-3 channels by a STIM1 coiled-coil mutant
18403424 The effects of 2-aminoethoxydiphenyl borate on orai1, orai2, orai3 metabolism in HEK293 cells with and without STIM1 are reported.
17452328 Results suggest that Orai1, -2, and -3 channels are similarly inhibited by extracellular calcium, indicating similar affinities for Ca(2+) within the selectivity filter.

AA Sequence

MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSRAKLKASSRTSALL      1 - 70
SGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTCILPNVEAVSNIHNLNSISESPHE     71 - 140
RMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQAALVSTIIMVPVGLI    141 - 210
FVVFTIHFYRSLVRHKTERHNREIEELHKLKVQLDGHERSLQVL                              211 - 254
//

Text Mined References (21)

PMID Year Title
25769459 2015 Orai1-Orai2 complex is involved in store-operated calcium entry in chondrocyte cell lines.
24603752 2014 Enhanced expression of Stim, Orai, and TRPC transcripts and proteins in endothelial progenitor cells isolated from patients with primary myelofibrosis.
24040356 2013 The contribution of Orai(CRACM)1 and Orai(CRACM)2 channels in store-operated Ca2+ entry and mediator release in human lung mast cells.
23890118 2013 The neglected CRAC proteins: Orai2, Orai3, and STIM2.
22640869 2012 Capacitative and non-capacitative signaling complexes in human platelets.
20607548 2011 Expression of Orai genes and I(CRAC) activation in the human retinal pigment epithelium.
20418871 2010 A novel EF-hand protein, CRACR2A, is a cytosolic Ca2+ sensor that stabilizes CRAC channels in T cells.
19706554 2009 Molecular determinants of fast Ca2+-dependent inactivation and gating of the Orai channels.
19506081 2009 Molecular determinants of the coupling between STIM1 and Orai channels: differential activation of Orai1-3 channels by a STIM1 coiled-coil mutant.
18403424 2008 2-Aminoethoxydiphenyl borate directly facilitates and indirectly inhibits STIM1-dependent gating of CRAC channels.
17452328 2007 Calcium inhibition and calcium potentiation of Orai1, Orai2, and Orai3 calcium release-activated calcium channels.
16807233 2006 Large store-operated calcium selective currents due to co-expression of Orai1 or Orai2 with the intracellular calcium sensor, Stim1.
16582901 2006 A mutation in Orai1 causes immune deficiency by abrogating CRAC channel function.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.