Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

AA Sequence

MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMYFFLSNLAFVD      1 - 70
FCYSSVITPKMLGNFLYKQNVISFDACATQLGCFLTFMVSESLLLASMAYDRYVAICNPLLYMVVMTPGI     71 - 140
CIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIVNHFYCDDMPLLRLTCSDTRFKQLWILACAGITFICS    141 - 210
VLIVFVSYMFIIFAILRMSSAEGRRKAFSTCSSHMLAVTIFYGTLIFMYLQPSSSHSLDADKMASVFYTV    211 - 280
IIPMLNPLIYSLRNKDVKDALKKVIINRNHAFIFLKLRK                                   281 - 319
//

Text Mined References (2)

PMID Year Title