Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MASGNLTWVTEFILVGVSDDPELQIPLFLVFLVLYLLTVAGNLGIITLTSVDPQLQTPMYFFLRHLAIIN      1 - 70
LCNSTVVAPKMLVNFLVTKKTISYYGCAAQLGGFLVFIVAEIFTLAAMAYDRYVAIWSPLLYAVVVSPKV     71 - 140
CRLLVSLTYLQSLITALTVSSCVFSVSYCSSNIINHFYCDDVPLLALSCSDTYIPETAVFIFSGTNLLFS    141 - 210
MIVVLISYFNIVITILRIRSSEGRQKAFSTCASHMIAVVVFYGTLLFMYLQPRSNHSLDTDKMASVFYTL    211 - 280
VIPVLNPLIYSLRNKNVKDALKRFLDNPCRSLKLM                                       281 - 315
//

Text Mined References (5)

PMID Year Title