Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.16
PubTator Score 0.36

Knowledge Summary

Patent (248)


  Disease (1)

Disease Target Count P-value
diabetes mellitus 1663 1.0e-03

AA Sequence

VVPMLNPLIYSLRNKDVKVALKKILNKNAFS                                           281 - 311

Text Mined References (6)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
11705801 2001 New GPCRs from a human lingual cDNA library.
9119360 1997 Specific repertoire of olfactory receptor genes in the male germ cells of several mammalian species.