Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.25
PubTator Score 0.50

Knowledge Summary

Patent (862)


  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 1.3e-09
osteosarcoma 7933 4.4e-05

Gene RIF (1)

22552337 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.

AA Sequence

TPMLNPFIYSLRNKDMKGSLGRLLLRATSLKEGTIAKLS                                   281 - 319

Text Mined References (6)

PMID Year Title
22552337 2012 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9500546 1998 Distribution of olfactory receptor genes in the human genome.