Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.13
PubTator Score 0.11

Knowledge Summary

Patent (533)

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8297 2.2e-11
pituitary cancer 1915 3.3e-08
medulloblastoma, large-cell 6086 1.7e-04
group 3 medulloblastoma 4002 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.100 1.1e-02
medulloblastoma, large-cell 1.300 1.7e-04
ovarian cancer 1.700 2.2e-11
pituitary cancer -2.200 3.3e-08

AA Sequence

MEPGNDTQISEFLLLGFSQEPGLQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMYFFLSNLSFAD      1 - 70
ICVTSTTIPKMLMNIQTQNKVITYIACLMQMYFFILFAGFENFLLSVMAYDRFVAICHPLHYMVIMNPHL     71 - 140
CGLLVLASWTMSALYSLLQILMVVRLSFCTALEIPHFFCELNQVIQLACSDSFLNHMVIYFTVALLGGGP    141 - 210
LTGILYSYSKIISSIHAISSAQGKYKAFSTCASHLSVVSLFYGAILGVYLSSAATRNSHSSATASVMYTV    211 - 280
VTPMLNPFIYSLRNKDIKRALGIHLLWGTMKGQFFKKCP                                   281 - 319
//

Text Mined References (9)

PMID Year Title