Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09
PubTator Score 0.10

Knowledge Summary

Patent (113)


  Disease (1)

Disease Target Count Z-score Confidence
Atrophic gastritis 5 3.218 1.6

Gene RIF (1)

20677014 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

PMMNPFIYSLRNQQVKQAFINMARKTVFFTST                                          281 - 312

Text Mined References (6)

PMID Year Title
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.