Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.44
PubTator Score 0.45

Knowledge Summary

Patent (285)


  Disease (1)

Disease Target Count P-value
non-small cell lung carcinoma 413 3.5e-20
lung carcinoma 2844 1.2e-19
lung adenocarcinoma 2714 1.0e-09
Breast cancer 3098 2.8e-07

AA Sequence

VIPMLNPLIYSLRNKEIKGALKRELRIKIFS                                           281 - 311

Text Mined References (3)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
11705801 2001 New GPCRs from a human lingual cDNA library.