Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent (51)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MEEENATLLTEFVLTGFLYQPQWKIPLFLAFLVIYLITIMGNLGLIAVIWKDPHLHIPMYLLLGNLAFVD      1 - 70
AWISSTVTPKMLNNFLAKSKMISLSECKIQFFSFAISVTTECFLLATMAYDRYVAICKPLLYPAIMTNGL     71 - 140
CIRLLILSYVGGILHALIHEGFLFRLTFCNSNIVHHIYCDTIPLSKISCTDSSINFLMVFIFSGSIQVFS    141 - 210
IVTILVSYTFVLFAILKKKSDKGVRKAFSTCGAHLFSVSLYYGPLLFIYVGPASPQADDQDMVEPLFYTV    211 - 280
IIPLLNPIIYSLRNKQVTVSFTKMLKKHVKVSY                                         281 - 313
//

Text Mined References (2)

PMID Year Title