Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent (110)


  Disease (1)

Disease Target Count P-value
diabetes mellitus 1663 1.4e-03


  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.100 1.4e-03

AA Sequence

NVLHNVIPPALNPLACALRMHKLRLGFQRLLGLGQDVSK                                   281 - 319

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.