Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1683 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6

Expression

AA Sequence

MNLDSFFSFLLKSLIMALSNSSWRLPQPSFFLVGIPGLEESQHWIALPLGILYLLALVGNVTILFIIWMD      1 - 70
PSLHQSMYLFLSMLAAIDLVVASSTAPKALAVLLVRAQEIGYTVCLIQMFFTHAFSSMESGVLVAMALDR     71 - 140
YVAICHPLHHSTILHPGVIGHIGMVVLVRGLLLLIPFLILLRKLIFCQATIIGHAYCEHMAVVKLACSET    141 - 210
TVNRAYGLTVALLVVGLDVLAIGVSYAHILQAVLKVPGNEARLKAFSTCGSHVCVILVFYIPGMFSFLTH    211 - 280
RFGHHVPHHVHVLLAILYRLVPPALNPLVYRVKTQKIHQ                                   281 - 319
//

Text Mined References (1)

PMID Year Title