Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.17

Knowledge Summary

Patent (158)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0

Gene RIF (1)

AA Sequence

MPTVNHSGTSHTVFHLLGIPGLQDQHMWISIPFFISYVTALLGNSLLIFIILTKRSLHEPMYLFLCMLAG      1 - 70
ADIVLSTCTIPQALAIFWFRAGDISLDRCITQLFFIHSTFISESGILLVMAFDHYIAICYPLRYTTILTN     71 - 140
ALIKKICVTVSLRSYGTIFPIIFLLKRLTFCQNNIIPHTFCEHIGLAKYACNDIRINIWYGFSILMSTVV    141 - 210
LDVVLIFISYMLILHAVFHMPSPDACHKALNTFGSHVCIIILFYGSGIFTILTQRFGRHIPPCIHIPLAN    211 - 280
VCILAPPMLNPIIYGIKTKQIQEQVVQFLFIKQK                                        281 - 314
//

Text Mined References (8)

PMID Year Title