Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.08
PubTator Score 1.58

Knowledge Summary

Patent (214)


  Disease (1)

Disease Target Count Z-score Confidence
Thalassemia 46 3.82 1.9

AA Sequence

NLYLLVPPFLNPIVYGVKTKQIRDHIVKVFFFKKVT                                      281 - 316

Text Mined References (2)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.