Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.24
PubTator Score 10.69

Knowledge Summary

Patent (1,033)

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.792 9.4e-03
cystic fibrosis -1.028 1.5e-03
atypical teratoid / rhabdoid tumor 1.400 3.7e-04
medulloblastoma, large-cell 1.600 3.2e-05
Breast cancer 3.700 2.2e-02
interstitial cystitis 2.200 4.8e-05
adult high grade glioma 1.300 1.7e-03
lung carcinoma 2.200 4.1e-26
ovarian cancer 1.500 2.4e-11

Gene RIF (5)

PMID Text
23969981 Olfactory receptor 51E1 as a novel target for diagnosis in somatostatin receptor-negative lung carcinoids.
23184910 OR51E1 protein is a potential novel clinical tissue biomarker for small intestine neuroendocrine carcinomas.
16491480 expression of PSGR and PSGR2 relative to AMACR in prostate cancer; AMACR was the most overexpressed, but in some cases expression of AMACR was not significantly elevated while PSGR and/or PSGR2 were substantially elevated
16206286 Results suggest that PSGR2 may be useful as a tissue marker and molecular target for the early detection and treatment of human prostate cancers.
12732197 This publication uses 'GPR136' as a name for this gene.

AA Sequence

MVDPNGNESSATYFILIGLPGLEEAQFWLAFPLCSLYLIAVLGNLTIIYIVRTEHSLHEPMYIFLCMLSG      1 - 70
IDILISTSSMPKMLAIFWFNSTTIQFDACLLQMFAIHSLSGMESTVLLAMAFDRYVAICHPLRHATVLTL     71 - 140
PRVTKIGVAAVVRGAALMAPLPVFIKQLPFCRSNILSHSYCLHQDVMKLACDDIRVNVVYGLIVIISAIG    141 - 210
LDSLLISFSYLLILKTVLGLTREAQAKAFGTCVSHVCAVFIFYVPFIGLSMVHRFSKRRDSPLPVILANI    211 - 280
YLLVPPVLNPIVYGVKTKEIRQRILRLFHVATHASEP                                     281 - 317
//

Text Mined References (11)

PMID Year Title
23969981 2013 Olfactory receptor 51E1 as a novel target for diagnosis in somatostatin receptor-negative lung carcinoids.
23184910 2013 Olfactory receptor 51E1 protein as a potential novel tissue biomarker for small intestine neuroendocrine carcinomas.
16491480 2006 The prostate-specific G-protein coupled receptors PSGR and PSGR2 are prostate cancer biomarkers that are complementary to alpha-methylacyl-CoA racemase.
16206286 2006 PSGR2, a novel G-protein coupled receptor, is overexpressed in human prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15313197 2004 D-GPCR: a novel putative G protein-coupled receptor overexpressed in prostate cancer and prostate.
14983052 2004 The human olfactory receptor gene family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12732197 2003 Novel human G-protein-coupled receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.