Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.11
PubTator Score 0.14

Knowledge Summary

Patent (136)


  Disease (2)

Disease Target Count P-value
diabetes mellitus 1663 1.1e-03
Disease Target Count Z-score Confidence
Anorexia nervosa 59 3.607 1.8

AA Sequence

LLLVPPLTNPIVYCVKTKQIRVRVVAKLCQRKI                                         281 - 313

Text Mined References (1)

PMID Year Title
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.