Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.88
PubTator Score 0.70

Knowledge Summary

Patent (249)


  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Prader-Willi syndrome 45 3.369 1.7

AA Sequence

LMNPMIYTLRNQEVKTSMKRLLSRHVVCQVDFIIRN                                      281 - 316

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.