Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent (121)


  Disease (1)

Disease Target Count P-value
diabetes mellitus 1663 1.1e-03

AA Sequence

MLNPIIYSLRNQEMKSAMQRLQRRLGPSESRKWG                                        281 - 314

Text Mined References (5)

PMID Year Title
23910658 2013 Identification of regions associated with variation in sensitivity to food-related odors in the human genome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.