Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.00
PubTator Score 33.27

Knowledge Summary

Patent (139)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 329 0.0 2.9

AA Sequence

MGSFNTSFEDGFILVGFSDWPQLEPILFVFIFIFYSLTLFGNTIIIALSWLDLRLHTPMYFFLSHLSLLD      1 - 70
LCFTTSTVPQLLINLCGVDRTITRGGCVAQLFIYLALGSTECVLLVVMAFDRYAAVCRPLHYMAIMHPHL     71 - 140
CQTLAIASWGAGFVNSLIQTGLAMAMPLCGHRLNHFFCEMPVFLKLACADTEGTEAKMFVARVIVVAVPA    141 - 210
ALILGSYVHIAHAVLRVKSTAGRRKAFGTCGSHLLVVFLFYGSAIYTYLQSIHNYSEREGKFVALFYTII    211 - 280
TPILNPLIYTLRNKDVKGALWKVLWRGRDSG                                           281 - 311
//

Text Mined References (4)

PMID Year Title