Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent (188)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Pulmonary hypertension 85 3.041 1.5

AA Sequence

MCSGNQTSQNQTASTDFTLTGLFAESKHAALLYTVTFLLFLMALTGNALLILLIHSEPRLHTPMYFFISQ      1 - 70
LALMDLMYLCVTVPKMLVGQVTGDDTISPSGCGIQMFFYLTLAGAEVFLLAAMAYDRYAAVCRPLHYPLL     71 - 140
MNQRVCQLLVSACWVLGMVDGLLLTPITMSFPFCQSRKILSFFCETPALLKLSCSDVSLYKTLMYLCCIL    141 - 210
MLLAPIMVISSSYTLILHLIHRMNSAAGHRKALATCSSHMIIVLLLFGASFYTYMLPSSYHTAEQDMMVS    211 - 280
AFYTIFTPVLNPLIYSLRNKDVTRALRSMMQSRMNQEK                                    281 - 318
//

Text Mined References (3)

PMID Year Title