Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.07
PubTator Score 12.07

Knowledge Summary

Patent (94)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Gene RIF (1)

AA Sequence

MAWENQTFNSDFLLLGIFNHSPTHTFLFFLVLAIFSVAFMGNSIMVLLIYLDTQLHTPMYFLLSQLSLMD      1 - 70
LMLICTTVPKMAFNYLSGSKSISMAGCATQIFFYISLLGSECFLLAVMSYDRYTAICHPLRYTNLMRPKI     71 - 140
CGLMTAFSWILGSTDGIIDAVATFSFSYCGSREIAHFCCDFPSLLILSCNDTSIFEEVIFICCIVMLVFP    141 - 210
VAIIITSYARVILAVIHMGSGEGRRKAFTTCSSHLMVVGMYYGAGLFMCIQPTSHHSPMQDKMVSVFYTI    211 - 280
VTPMLNPLIYSLRNKEVTRALMKILGKGKSGD                                          281 - 312
//

Text Mined References (5)

PMID Year Title