Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.20
PubTator Score 31.07

Knowledge Summary

Patent (236)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (1)

AA Sequence

MMIKKNASSEDFFILLGFSNWPQLEVVLFVVILIFYLMTLTGNLFIIILSYVDSHLHTPMYFFLSNLSFL      1 - 70
DLCHTTSSIPQLLVNLRGPEKTISYAGCMVQLYFVLALGIAECVLLVVMSYDRYVAVCRPLHYTVLMHPR     71 - 140
FCHLLAAASWVIGFTISALHSSFTFWVPLCGHRLVDHFFCEVPALLRLSCVDTHANELTLMVMSSIFVLI    141 - 210
PLILILTAYGAIARAVLSMQSTTGLQKVFRTCGAHLMVVSLFFIPVMCMYLQPPSENSPDQGKFIALFYT    211 - 280
VVTPSLNPLIYTLRNKHVKGAAKRLLGWEWGK                                          281 - 312
//

Text Mined References (9)

PMID Year Title