Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.98
PubTator Score 52.54

Knowledge Summary

Patent (115)

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.300 6.6e-04
atypical teratoid / rhabdoid tumor 1.100 3.7e-03
medulloblastoma, large-cell 1.600 6.5e-05
Multiple Sclerosis 1.500 4.3e-03
osteosarcoma 1.095 2.8e-05
ovarian cancer 1.100 1.4e-10
ulcerative colitis -1.300 6.9e-05

Gene RIF (2)

AA Sequence

MVNQSSPMGFLLLGFSEHPALERTLFVVVFTSYLLTLVGNTLIILLSVLYPRLHSPMYFFLSDLSFLDLC      1 - 70
FTTSCVPQMLVNLWGPKKTISFLGCSVQLFIFLSLGTTECILLTVMAFDRYVAVCQPLHYATIIHPRLCW     71 - 140
QLASVAWVMSLVQSIVQTPSTLHLPFCPHQQIDDFLCEVPSLIRLSCGDTSYNEIQLAVSSVIFVVVPLS    141 - 210
LILASYGATAQAVLRINSATAWRKAFGTCSSHLTVVTLFYSSVIAVYLQPKNPYAQGRGKFFGLFYAVGT    211 - 280
PSLNPLVYTLRNKEIKRALRRLLGKERDSRESWRAA                                      281 - 316
//

Text Mined References (10)

PMID Year Title