Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent (5,835)

AA Sequence

MGTDNQTWVSEFILLGLSSDWDTRVSLFVLFLVMYVVTVLGNCLIVLLIRLDSRLHTPMYFFLTNLSLVD      1 - 70
VSYATSVVPQLLAHFLAEHKAIPFQSCAAQLFFSLALGGIEFVLLAVMAYDRYVAVCDALRYSAIMHGGL     71 - 140
CARLAITSWVSGFISSPVQTAITFQLPMCRNKFIDHISCELLAVVRLACVDTSSNEVTIMVSSIVLLMTP    141 - 210
FCLVLLSYIQIISTILKIQSREGRKKAFHTCASHLTVVALCYGVAIFTYIQPHSSPSVLQEKLFSVFYAI    211 - 280
LTPMLNPMIYSLRNKEVKGAWQKLLWKFSGLTSKLAT                                     281 - 317
//

Text Mined References (11)

PMID Year Title