Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.10
PubTator Score 8.08

Knowledge Summary

Patent (300)


  Disease (2)

Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1170 0.0 1.0
Disease Target Count Z-score Confidence
post-traumatic stress disorder 45 3.506 1.8


AA Sequence

IAPMLNPLIYTLRNKEVKEGFKRLVARVFLIKK                                         281 - 313

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9500546 1998 Distribution of olfactory receptor genes in the human genome.