Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 3.25

Knowledge Summary

Patent (262)


  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 3.1e-06

AA Sequence

VTPMLNPFIYSLRNGDVKGGFMKWMSRMQTFFFR                                        281 - 314

Text Mined References (6)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9119360 1997 Specific repertoire of olfactory receptor genes in the male germ cells of several mammalian species.