Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.15
PubTator Score 1.10

Knowledge Summary

Patent (6,719)

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7766 2.6e-08
ovarian cancer 8297 3.4e-07
diabetes mellitus 1683 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5
Disease Target Count Z-score Confidence
Amenorrhea 56 3.083 1.5

AA Sequence

MSGTNQSSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILSVSIDSCLHTPMYFFLSNLSFVD      1 - 70
ICFSFTTVPKMLANHILETQTISFCGCLTQMYFVFMFVDMDNFLLAVMAYDHFVAVCHPLHYTAKMTHQL     71 - 140
CALLVAGLWVVANLNVLLHTLLMAPLSFCADNAITHFFCDVTPLLKLSCSDTHLNEVIILSEGALVMITP    141 - 210
FLCILASYMHITCTVLKVPSTKGRWKAFSTCGSHLAVVLLFYSTIIAVYFNPLSSHSAEKDTMATVLYTV    211 - 280
VTPMLNPFIYSLRNRYLKGALKKVVGRVVFSV                                          281 - 312
//

Text Mined References (7)

PMID Year Title