Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.40

Knowledge Summary

Patent

No data available

AA Sequence

MDGDNQSENSQFLLLGISESPEQQQILFWMFLSMYLVTVLGNVLIILAISSDSHLHTPMYFFLANLSFTD      1 - 70
LFFVTNTIPKMLVNFQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAYDRYVAICCPLHYVTAMSPGL     71 - 140
CVLLLSLCWGLSVLYGLLLTFLLTRVTFCGPREIHYLFCDMYILLWLACSNTHIIHTALIATGCFIFLTL    141 - 210
LGFMTTSYVRIVRTILQMPSASKKYKTFSTCASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVL    211 - 280
TPMMNPFIYSLRNKDMHGAPGRVLWRPFQRP                                           281 - 311
//

Text Mined References (5)

PMID Year Title