Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.82
PubTator Score 36.69

Knowledge Summary

Patent (586)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 2.0e-05
psoriasis 6685 2.0e-03
Disease Target Count Z-score Confidence
Infertility 163 3.105 1.6

Gene RIF (3)

PMID Text
23525651 The present preliminary study seems to confirm the important role of OR1D2 both in nose and spermatozoa and may explain the idiopathic infertility of the study group.
21454689 the homo-oligomerization status of the human OR1740 receptor and its involvement in receptor activation upon odorant ligand binding were addressed
12663925 results indicate that hOR17-4 functions in human sperm chemotaxis and may be a critical component of the fertilization process

AA Sequence

MDGGNQSEGSEFLLLGMSESPEQQRILFWMFLSMYLVTVVGNVLIILAISSDSRLHTPVYFFLANLSFTD      1 - 70
LFFVTNTIPKMLVNLQSHNKAISYAGCLTQLYFLVSLVALDNLILAVMAYDRYVAICCPLHYTTAMSPKL     71 - 140
CILLLSLCWVLSVLYGLIHTLLMTRVTFCGSRKIHYIFCEMYVLLRMACSNIQINHTVLIATGCFIFLIP    141 - 210
FGFVIISYVLIIRAILRIPSVSKKYKAFSTCASHLGAVSLFYGTLCMVYLKPLHTYSVKDSVATVMYAVV    211 - 280
TPMMNPFIYSLRNKDMHGALGRLLDKHFKRLT                                          281 - 312
//

Text Mined References (17)

PMID Year Title
23525651 2013 Human olfactory sensitivity for bourgeonal and male infertility: a preliminary investigation.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
21454689 2011 Relationship between homo-oligomerization of a mammalian olfactory receptor and its activation state demonstrated by bioluminescence resonance energy transfer.
16820410 2006 Novel function of beta-arrestin2 in the nucleus of mature spermatozoa.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15458659 2004 Dual capacity of a human olfactory receptor.
14983052 2004 The human olfactory receptor gene family.
12663925 2003 Identification of a testicular odorant receptor mediating human sperm chemotaxis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.
8665947 1996 Overexpression, solubilization and purification of rat and human olfactory receptors.
8097991 1993 The OLFR1 gene encoding the HGMP07E putative olfactory receptor maps to the 17p13-->p12 region of the human genome and reveals an MspI restriction fragment length polymorphism.
8004088 1994 Olfactory receptor gene cluster on human chromosome 17: possible duplication of an ancestral receptor repertoire.
1840504 1991 A novel multigene family may encode odorant receptors: a molecular basis for odor recognition.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.
1315913 1992 Novel G protein-coupled receptors: a gene family of putative human olfactory receptor sequences.