Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 9.33

Knowledge Summary

Patent (105)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Kidney cancer 2613 0.0 0.5

AA Sequence

MFPANWTSVKVFFFLGFFHYPKVQVIIFAVCLLMYLITLLGNIFLISITILDSHLHTPMYLFLSNLSFLD      1 - 70
IWYSSSALSPMLANFVSGRNTISFSGCATQMYLSLAMGSTECVLLPMMAYDRYVAICNPLRYPVIMNRRT     71 - 140
CVQIAAGSWMTGCLTAMVEMMSVLPLSLCGNSIINHFTCEILAILKLVCVDTSLVQLIMLVISVLLLPMP    141 - 210
MLLICISYAFILASILRISSVEGRSKAFSTCTAHLMVVVLFYGTALSMHLKPSAVDSQEIDKFMALVYAG    211 - 280
QTPMLNPIIYSLRNKEVKVALKKLLIRNHFNTAFISILK                                   281 - 319
//

Text Mined References (3)

PMID Year Title