Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.50
PubTator Score 4.50

Knowledge Summary

Patent (173)


  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

SMFYGVVTPMLNPIIYSLRNKDVKAAIKYLLSRKAINQ                                    281 - 318

Text Mined References (6)

PMID Year Title