Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MNNSQISTVTQFVLLGFPGPWKIQIIFFSMILLVYIFTLTGNMAIICAVRWDHRLHTPMYVLLANFSFLE      1 - 70
IWYVTCTVPNMLVNFFSKTKTISFSGCFTQFHFFFSLGTTECFFLCVMAYDRYLAICHPLHYPSIMTGQL     71 - 140
CGILVSLCWLIGFLGHSISIFFIFQLPFCGPNIIDHFLCDVDPLMALSSAPTHIIGHVFHSVSSLFINLT    141 - 210
MVYILGSYTLVLRTVLQVPSSAGWQKAISTCGSHLVVVSLFYGAIMLMYVSPTPGNSVAMHKLITLIYSV    211 - 280
VTPVLNPLIYSLRNKDMKYALHHVFCGMRIIQRS                                        281 - 314
//

Text Mined References (6)

PMID Year Title