Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 126.73

Knowledge Summary

Patent (397)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Gene RIF (1)

AA Sequence

MRGFNKTTVVTQFILVGFSSLGELQLLLFVIFLLLYLTILVANVTIMAVIRFSWTLHTPMYGFLFILSFS      1 - 70
ESCYTFVIIPQLLVHLLSDTKTISFMACATQLFFFLGFACTNCLLIAVMGYDRYVAICHPLRYTLIINKR     71 - 140
LGLELISLSGATGFFIALVATNLICDMRFCGPNRVNHYFCDMAPVIKLACTDTHVKELALFSLSILVIMV    141 - 210
PFLLILISYGFIVNTILKIPSAEGKKAFVTCASHLTVVFVHYGCASIIYLRPKSKSASDKDQLVAVTYTV    211 - 280
VTPLLNPLVYSLRNKEVKTALKRVLGMPVATKMS                                        281 - 314
//

Text Mined References (3)

PMID Year Title