Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 172.83

Knowledge Summary

Patent (463)


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.0
Liver cancer 589 0.0 0.5

Gene RIF (1)

AA Sequence

LTPLFNPMIYSLRNKEFKSALRRTIGQTFYPLS                                         281 - 313

Text Mined References (5)

PMID Year Title