Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent (99)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (2)

AA Sequence

MSNASLVTAFILTGLPHAPGLDALLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYFLTNLSFIDMW      1 - 70
FSTVTVPKMLMTLVSPSGRAISFHSCVAQLYFFHFLGSTECFLYTVMSYDRYLAISYPLRYTSMMSGSRC     71 - 140
ALLATGTWLSGSLHSAVQTILTFHLPYCGPNQIQHYFCDAPPILKLACADTSANVMVIFVDIGIVASGCF    141 - 210
VLIVLSYVSIVCSILRIRTSDGRRRAFQTCASHCIVVLCFFVPCVVIYLRPGSMDAMDGVVAIFYTVLTP    211 - 280
LLNPVVYTLRNKEVKKAVLKLRDKVAHPQRK                                           281 - 311
//

Text Mined References (3)

PMID Year Title